Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2889
Gene name
Locationscaffold_23:79294..80854
Strand-
Gene length (bp)1560
Transcript length (bp)1368
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 5.1E-65 133 376
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.2E-30 7 105

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53584|YTP1_YEAST Protein YTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTP1 PE=1 SV=1 122 431 8.0E-68
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 118 363 2.0E-10
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 157 341 8.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 54 72 18
3 82 104 22
4 125 147 22
5 157 179 22
6 253 275 22
7 280 302 22
8 315 337 22
9 352 374 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 116.08 62.43 169.72
CcL In ants, during behavior modification 190.56 90.28 290.85
CcD In ants, recently dead 99.72 54.14 145.30

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.040106 yes
SC16a CcD 0.545109 no
CcL CcD 0.006982 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2889
MSSKISAGESVSKEPIDTVLWVHIFVQTFAYGVVFPIGMVLGMTKSRWHVPTQIFGSVFAVLGFVLGHAHGGREF
IAGNAHSGFATILQLLLICQVVLGLYLKGHWERGLNGRIRGFIRPCHSVIGKLMPVLSWTQMLFGGITSLGFCQA
DHFGQCLAHFIMGSAFIAYGIVLSIILVVGQMWMRRSGRSQEFYDSAVIAAWGCVNTFTEHRWGSAWIRNDWQHT
TMGIIWWSAGLAGMWLSRDRDGNPKRNFVPGFVIFMTGWAMSAHPQSLMISAMTHSMFGKTLMAVGLTRIIEIAF
VLKDKQSLTDDGRSWNSFQFIPIFLMYAAGFLFMGATEEQMVLVDKSALDHVSYILIMFSVAFMVFLFSNVLIHL
YDRLANPLENRDEGLYDRLATPAVENRDLGATGRISTDRRMRDADEFELDGLMSDDDGPSSRGLDSPSSTLGKNE
ASSVR
Coding >Ophio5|2889
ATGAGCAGCAAAATCTCCGCGGGCGAGTCCGTCTCCAAGGAGCCCATCGATACCGTGCTATGGGTTCACATATTC
GTCCAGACGTTCGCCTACGGCGTCGTCTTTCCGATCGGAATGGTGCTGGGCATGACGAAATCGAGATGGCATGTC
CCGACTCAAATCTTCGGCTCCGTCTTCGCCGTCCTCGGCTTCGTCCTCGGCCACGCCCACGGAGGTCGTGAGTTC
ATCGCCGGCAACGCCCACTCCGGCTTCGCAACTATCCTGCAGTTGCTCCTCATCTGCCAGGTCGTTCTCGGGCTC
TACCTCAAGGGCCACTGGGAGAGGGGGCTCAACGGCAGGATCAGGGGCTTCATCCGGCCGTGCCACTCCGTCATT
GGCAAGCTCATGCCTGTCCTGTCGTGGACCCAGATGCTCTTTGGCGGCATCACCTCGCTCGGCTTCTGCCAGGCC
GACCATTTCGGCCAATGTCTAGCTCACTTCATCATGGGCAGCGCCTTCATCGCCTACGGCATCGTCCTGTCCATC
ATCCTCGTCGTCGGTCAGATGTGGATGCGCCGCTCCGGACGTTCGCAAGAATTCTACGACAGTGCCGTCATCGCC
GCCTGGGGCTGCGTCAATACCTTTACCGAGCACCGTTGGGGAAGCGCATGGATCAGAAACGACTGGCAGCACACC
ACCATGGGCATCATCTGGTGGAGCGCGGGCCTGGCCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAG
CGCAACTTTGTCCCCGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTGATGATC
AGTGCCATGACGCACAGCATGTTTGGGAAGACGCTGATGGCCGTCGGCCTGACCCGCATCATCGAGATTGCCTTT
GTTCTCAAGGACAAGCAGTCACTGACGGATGACGGTCGCTCCTGGAACAGTTTTCAGTTTATTCCCATATTCCTC
ATGTACGCCGCCGGTTTCCTCTTTATGGGGGCGACTGAGGAGCAGATGGTGCTCGTCGATAAGTCTGCCCTCGAC
CACGTCTCATACATCCTAATCATGTTTTCCGTGGCCTTTATGGTCTTTTTGTTCTCCAACGTGCTCATCCATCTG
TATGACCGGCTCGCGAACCCGCTGGAGAACAGGGACGAGGGCTTGTATGACCGGCTTGCGACTCCCGCCGTGGAG
AATAGGGATTTAGGCGCTACCGGCCGGATATCGACCGACAGGCGGATGCGGGACGCCGACGAGTTTGAACTCGAC
GGCTTGATGAGCGATGACGACGGACCATCTTCTCGGGGTCTCGACTCGCCGTCATCGACACTGGGCAAAAACGAG
GCATCGTCTGTGCGT
Transcript >Ophio5|2889
ATGAGCAGCAAAATCTCCGCGGGCGAGTCCGTCTCCAAGGAGCCCATCGATACCGTGCTATGGGTTCACATATTC
GTCCAGACGTTCGCCTACGGCGTCGTCTTTCCGATCGGAATGGTGCTGGGCATGACGAAATCGAGATGGCATGTC
CCGACTCAAATCTTCGGCTCCGTCTTCGCCGTCCTCGGCTTCGTCCTCGGCCACGCCCACGGAGGTCGTGAGTTC
ATCGCCGGCAACGCCCACTCCGGCTTCGCAACTATCCTGCAGTTGCTCCTCATCTGCCAGGTCGTTCTCGGGCTC
TACCTCAAGGGCCACTGGGAGAGGGGGCTCAACGGCAGGATCAGGGGCTTCATCCGGCCGTGCCACTCCGTCATT
GGCAAGCTCATGCCTGTCCTGTCGTGGACCCAGATGCTCTTTGGCGGCATCACCTCGCTCGGCTTCTGCCAGGCC
GACCATTTCGGCCAATGTCTAGCTCACTTCATCATGGGCAGCGCCTTCATCGCCTACGGCATCGTCCTGTCCATC
ATCCTCGTCGTCGGTCAGATGTGGATGCGCCGCTCCGGACGTTCGCAAGAATTCTACGACAGTGCCGTCATCGCC
GCCTGGGGCTGCGTCAATACCTTTACCGAGCACCGTTGGGGAAGCGCATGGATCAGAAACGACTGGCAGCACACC
ACCATGGGCATCATCTGGTGGAGCGCGGGCCTGGCCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAG
CGCAACTTTGTCCCCGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTGATGATC
AGTGCCATGACGCACAGCATGTTTGGGAAGACGCTGATGGCCGTCGGCCTGACCCGCATCATCGAGATTGCCTTT
GTTCTCAAGGACAAGCAGTCACTGACGGATGACGGTCGCTCCTGGAACAGTTTTCAGTTTATTCCCATATTCCTC
ATGTACGCCGCCGGTTTCCTCTTTATGGGGGCGACTGAGGAGCAGATGGTGCTCGTCGATAAGTCTGCCCTCGAC
CACGTCTCATACATCCTAATCATGTTTTCCGTGGCCTTTATGGTCTTTTTGTTCTCCAACGTGCTCATCCATCTG
TATGACCGGCTCGCGAACCCGCTGGAGAACAGGGACGAGGGCTTGTATGACCGGCTTGCGACTCCCGCCGTGGAG
AATAGGGATTTAGGCGCTACCGGCCGGATATCGACCGACAGGCGGATGCGGGACGCCGACGAGTTTGAACTCGAC
GGCTTGATGAGCGATGACGACGGACCATCTTCTCGGGGTCTCGACTCGCCGTCATCGACACTGGGCAAAAACGAG
GCATCGTCTGTGCGTTGA
Gene >Ophio5|2889
ATGAGCAGCAAAATCTCCGCGGGCGAGTCCGTCTCCAAGGAGCCCATCGTGAGTGGCGTCTACCCCCGACGCGTC
GGAGTTTTTTTTTTTCTTCCTTCTATTATTCTCTTGCTAACCCGTCGCGCAGGATACCGTGCTATGGGTTCACAT
ATTCGTCCAGACGTTCGCCTACGGCGTCGTCTTTCCGATCGGAATGGTGCTGGGCGTACGTTGGCACTACTTTTC
ATTGTCCTGACCAATGCACGACGCTGACTCTCGTCGACAGATGACGAAATCGAGATGGCATGTCCCGACTCAAAT
CTTCGGCTCCGTCTTCGCCGTCCTCGGCTTCGTCCTCGGCCACGCCCACGGAGGTCGTGAGTTCATCGCCGGCAA
CGCCCACTCCGGCTTCGCAACTATCCTGCAGTTGCTCCTCATCTGCCAGGTCGTTCTCGGGCTCTACCTCAAGGG
CCACTGGGAGAGGGGGCTCAACGGCAGGATCAGGGGCTTCATCCGGCCGTGCCACTCCGTCATTGGCAAGCTCAT
GCCTGTCCTGTCGTGGACCCAGATGCTCTTTGGCGGCATCACCTCGCTCGGCTTCTGCCAGGCCGACCATTTCGG
CCAATGTCTAGCTCACTTCATCATGGGCAGCGCCTTCATCGCCTACGGCATCGTCCTGTCCATCATCCTCGTCGT
CGGTCAGATGTGGATGCGCCGCTCCGGACGTTCGCAAGAATTCTACGACAGTGCCGTCATCGCCGCCTGGGGCTG
CGTCAATACCTTTACCGAGCACCGTTGGGGAAGCGCATGGATCAGAAACGACTGGCAGCACACCACCATGGGCAT
CATCTGGTGGAGCGCGGGCCTGGCCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAGCGCAACTTTGT
CCCCGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTGATGATCAGTGCCATGAC
GCACAGCATGTTTGGGAAGACGCTGATGGCCGTCGGCCTGACCCGCATCATCGAGATTGCCTTTGTTCTCAAGGA
CAAGCAGTCACTGACGGATGACGGTCGCTCCTGGAACAGTTTTCAGTTTATTCCCATATTCGTGAGTTCGGCCAT
CTTTGACTACCACGGCCGGCCAGCACTGACTCCCTCCAGCTCATGTACGCCGCCGGTTTCCTCTTTATGGGGGCG
ACTGAGGAGCAGATGGTGCTCGTCGATAAGTCTGCCCTCGACCACGTCTCATACATCCTAATCATGTTTTCCGTG
GCCTTTATGGTCTTTTTGTTCTCCAACGTGCTCATCCATCTGTATGACCGGCTCGCGAACCCGCTGGAGAACAGG
GACGAGGGCTTGTATGACCGGCTTGCGACTCCCGCCGTGGAGAATAGGGATTTAGGCGCTACCGGCCGGATATCG
ACCGACAGGCGGATGCGGGACGCCGACGAGTTTGAACTCGACGGCTTGATGAGCGATGACGACGGACCATCTTCT
CGGGGTCTCGACTCGCCGTCATCGACACTGGGCAAAAACGAGGCATCGTCTGTGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail