Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2889
Gene name
Locationscaffold_23:79294..80854
Strand-
Gene length (bp)1560
Transcript length (bp)1368
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 5.1E-65 133 376
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.2E-30 7 105

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53584|YTP1_YEAST Protein YTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTP1 PE=1 SV=1 122 431 8.0E-68
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 118 363 2.0E-10
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 157 341 8.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 54 72 18
3 82 104 22
4 125 147 22
5 157 179 22
6 253 275 22
7 280 302 22
8 315 337 22
9 352 374 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2889
MSSKISAGESVSKEPIDTVLWVHIFVQTFAYGVVFPIGMVLGMTKSRWHVPTQIFGSVFAVLGFVLGHAHGGREF
IAGNAHSGFATILQLLLICQVVLGLYLKGHWERGLNGRIRGFIRPCHSVIGKLMPVLSWTQMLFGGITSLGFCQA
DHFGQCLAHFIMGSAFIAYGIVLSIILVVGQMWMRRSGRSQEFYDSAVIAAWGCVNTFTEHRWGSAWIRNDWQHT
TMGIIWWSAGLAGMWLSRDRDGNPKRNFVPGFVIFMTGWAMSAHPQSLMISAMTHSMFGKTLMAVGLTRIIEIAF
VLKDKQSLTDDGRSWNSFQFIPIFLMYAAGFLFMGATEEQMVLVDKSALDHVSYILIMFSVAFMVFLFSNVLIHL
YDRLANPLENRDEGLYDRLATPAVENRDLGATGRISTDRRMRDADEFELDGLMSDDDGPSSRGLDSPSSTLGKNE
ASSVR
Coding >Ophio5|2889
ATGAGCAGCAAAATCTCCGCGGGCGAGTCCGTCTCCAAGGAGCCCATCGATACCGTGCTATGGGTTCACATATTC
GTCCAGACGTTCGCCTACGGCGTCGTCTTTCCGATCGGAATGGTGCTGGGCATGACGAAATCGAGATGGCATGTC
CCGACTCAAATCTTCGGCTCCGTCTTCGCCGTCCTCGGCTTCGTCCTCGGCCACGCCCACGGAGGTCGTGAGTTC
ATCGCCGGCAACGCCCACTCCGGCTTCGCAACTATCCTGCAGTTGCTCCTCATCTGCCAGGTCGTTCTCGGGCTC
TACCTCAAGGGCCACTGGGAGAGGGGGCTCAACGGCAGGATCAGGGGCTTCATCCGGCCGTGCCACTCCGTCATT
GGCAAGCTCATGCCTGTCCTGTCGTGGACCCAGATGCTCTTTGGCGGCATCACCTCGCTCGGCTTCTGCCAGGCC
GACCATTTCGGCCAATGTCTAGCTCACTTCATCATGGGCAGCGCCTTCATCGCCTACGGCATCGTCCTGTCCATC
ATCCTCGTCGTCGGTCAGATGTGGATGCGCCGCTCCGGACGTTCGCAAGAATTCTACGACAGTGCCGTCATCGCC
GCCTGGGGCTGCGTCAATACCTTTACCGAGCACCGTTGGGGAAGCGCATGGATCAGAAACGACTGGCAGCACACC
ACCATGGGCATCATCTGGTGGAGCGCGGGCCTGGCCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAG
CGCAACTTTGTCCCCGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTGATGATC
AGTGCCATGACGCACAGCATGTTTGGGAAGACGCTGATGGCCGTCGGCCTGACCCGCATCATCGAGATTGCCTTT
GTTCTCAAGGACAAGCAGTCACTGACGGATGACGGTCGCTCCTGGAACAGTTTTCAGTTTATTCCCATATTCCTC
ATGTACGCCGCCGGTTTCCTCTTTATGGGGGCGACTGAGGAGCAGATGGTGCTCGTCGATAAGTCTGCCCTCGAC
CACGTCTCATACATCCTAATCATGTTTTCCGTGGCCTTTATGGTCTTTTTGTTCTCCAACGTGCTCATCCATCTG
TATGACCGGCTCGCGAACCCGCTGGAGAACAGGGACGAGGGCTTGTATGACCGGCTTGCGACTCCCGCCGTGGAG
AATAGGGATTTAGGCGCTACCGGCCGGATATCGACCGACAGGCGGATGCGGGACGCCGACGAGTTTGAACTCGAC
GGCTTGATGAGCGATGACGACGGACCATCTTCTCGGGGTCTCGACTCGCCGTCATCGACACTGGGCAAAAACGAG
GCATCGTCTGTGCGT
Transcript >Ophio5|2889
ATGAGCAGCAAAATCTCCGCGGGCGAGTCCGTCTCCAAGGAGCCCATCGATACCGTGCTATGGGTTCACATATTC
GTCCAGACGTTCGCCTACGGCGTCGTCTTTCCGATCGGAATGGTGCTGGGCATGACGAAATCGAGATGGCATGTC
CCGACTCAAATCTTCGGCTCCGTCTTCGCCGTCCTCGGCTTCGTCCTCGGCCACGCCCACGGAGGTCGTGAGTTC
ATCGCCGGCAACGCCCACTCCGGCTTCGCAACTATCCTGCAGTTGCTCCTCATCTGCCAGGTCGTTCTCGGGCTC
TACCTCAAGGGCCACTGGGAGAGGGGGCTCAACGGCAGGATCAGGGGCTTCATCCGGCCGTGCCACTCCGTCATT
GGCAAGCTCATGCCTGTCCTGTCGTGGACCCAGATGCTCTTTGGCGGCATCACCTCGCTCGGCTTCTGCCAGGCC
GACCATTTCGGCCAATGTCTAGCTCACTTCATCATGGGCAGCGCCTTCATCGCCTACGGCATCGTCCTGTCCATC
ATCCTCGTCGTCGGTCAGATGTGGATGCGCCGCTCCGGACGTTCGCAAGAATTCTACGACAGTGCCGTCATCGCC
GCCTGGGGCTGCGTCAATACCTTTACCGAGCACCGTTGGGGAAGCGCATGGATCAGAAACGACTGGCAGCACACC
ACCATGGGCATCATCTGGTGGAGCGCGGGCCTGGCCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAG
CGCAACTTTGTCCCCGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTGATGATC
AGTGCCATGACGCACAGCATGTTTGGGAAGACGCTGATGGCCGTCGGCCTGACCCGCATCATCGAGATTGCCTTT
GTTCTCAAGGACAAGCAGTCACTGACGGATGACGGTCGCTCCTGGAACAGTTTTCAGTTTATTCCCATATTCCTC
ATGTACGCCGCCGGTTTCCTCTTTATGGGGGCGACTGAGGAGCAGATGGTGCTCGTCGATAAGTCTGCCCTCGAC
CACGTCTCATACATCCTAATCATGTTTTCCGTGGCCTTTATGGTCTTTTTGTTCTCCAACGTGCTCATCCATCTG
TATGACCGGCTCGCGAACCCGCTGGAGAACAGGGACGAGGGCTTGTATGACCGGCTTGCGACTCCCGCCGTGGAG
AATAGGGATTTAGGCGCTACCGGCCGGATATCGACCGACAGGCGGATGCGGGACGCCGACGAGTTTGAACTCGAC
GGCTTGATGAGCGATGACGACGGACCATCTTCTCGGGGTCTCGACTCGCCGTCATCGACACTGGGCAAAAACGAG
GCATCGTCTGTGCGTTGA
Gene >Ophio5|2889
ATGAGCAGCAAAATCTCCGCGGGCGAGTCCGTCTCCAAGGAGCCCATCGTGAGTGGCGTCTACCCCCGACGCGTC
GGAGTTTTTTTTTTTCTTCCTTCTATTATTCTCTTGCTAACCCGTCGCGCAGGATACCGTGCTATGGGTTCACAT
ATTCGTCCAGACGTTCGCCTACGGCGTCGTCTTTCCGATCGGAATGGTGCTGGGCGTACGTTGGCACTACTTTTC
ATTGTCCTGACCAATGCACGACGCTGACTCTCGTCGACAGATGACGAAATCGAGATGGCATGTCCCGACTCAAAT
CTTCGGCTCCGTCTTCGCCGTCCTCGGCTTCGTCCTCGGCCACGCCCACGGAGGTCGTGAGTTCATCGCCGGCAA
CGCCCACTCCGGCTTCGCAACTATCCTGCAGTTGCTCCTCATCTGCCAGGTCGTTCTCGGGCTCTACCTCAAGGG
CCACTGGGAGAGGGGGCTCAACGGCAGGATCAGGGGCTTCATCCGGCCGTGCCACTCCGTCATTGGCAAGCTCAT
GCCTGTCCTGTCGTGGACCCAGATGCTCTTTGGCGGCATCACCTCGCTCGGCTTCTGCCAGGCCGACCATTTCGG
CCAATGTCTAGCTCACTTCATCATGGGCAGCGCCTTCATCGCCTACGGCATCGTCCTGTCCATCATCCTCGTCGT
CGGTCAGATGTGGATGCGCCGCTCCGGACGTTCGCAAGAATTCTACGACAGTGCCGTCATCGCCGCCTGGGGCTG
CGTCAATACCTTTACCGAGCACCGTTGGGGAAGCGCATGGATCAGAAACGACTGGCAGCACACCACCATGGGCAT
CATCTGGTGGAGCGCGGGCCTGGCCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAGCGCAACTTTGT
CCCCGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTGATGATCAGTGCCATGAC
GCACAGCATGTTTGGGAAGACGCTGATGGCCGTCGGCCTGACCCGCATCATCGAGATTGCCTTTGTTCTCAAGGA
CAAGCAGTCACTGACGGATGACGGTCGCTCCTGGAACAGTTTTCAGTTTATTCCCATATTCGTGAGTTCGGCCAT
CTTTGACTACCACGGCCGGCCAGCACTGACTCCCTCCAGCTCATGTACGCCGCCGGTTTCCTCTTTATGGGGGCG
ACTGAGGAGCAGATGGTGCTCGTCGATAAGTCTGCCCTCGACCACGTCTCATACATCCTAATCATGTTTTCCGTG
GCCTTTATGGTCTTTTTGTTCTCCAACGTGCTCATCCATCTGTATGACCGGCTCGCGAACCCGCTGGAGAACAGG
GACGAGGGCTTGTATGACCGGCTTGCGACTCCCGCCGTGGAGAATAGGGATTTAGGCGCTACCGGCCGGATATCG
ACCGACAGGCGGATGCGGGACGCCGACGAGTTTGAACTCGACGGCTTGATGAGCGATGACGACGGACCATCTTCT
CGGGGTCTCGACTCGCCGTCATCGACACTGGGCAAAAACGAGGCATCGTCTGTGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail