Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2880
Gene name
Locationscaffold_23:52999..53761
Strand+
Gene length (bp)762
Transcript length (bp)579
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13185 GAF_2 GAF domain 6.1E-09 77 187
PF01590 GAF GAF domain 2.8E-05 104 187

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36088|FRMSR_YEAST Free methionine-R-sulfoxide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL069W PE=1 SV=1 38 190 1.0E-46
sp|O34553|YTSP_BACSU Protein YtsP OS=Bacillus subtilis (strain 168) GN=ytsP PE=3 SV=2 37 186 6.0E-34
sp|O66116|Y507_ZYMMO Protein ZMO0507 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO0507 PE=3 SV=1 43 187 3.0E-26
sp|P76270|MSRC_ECOLI Free methionine-R-sulfoxide reductase OS=Escherichia coli (strain K12) GN=msrC PE=1 SV=2 32 182 1.0E-24
sp|Q8MTJ7|GAFA_DICDI GAF domain-containing protein A OS=Dictyostelium discoideum GN=gafA PE=3 SV=1 38 186 1.0E-24

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2880
MLISSMTSPRMRPTTSFCFRPERCLRASAIGFVSAGRSCEASIDSSNEQVCNLANAASLLWHAYKAMPAPSNAVN
WAGFYVMDRTSSQLRLLLGPFQGKVACQSIELGRGVCGRAAALGETQVVEDVGEDADHIACDSATKSEIVVPVMV
GASGRDVVAVIDVDCAAKRGFDECDKRKLQRLAELLAEGCDW
Coding >Ophio5|2880
ATGCTGATTTCGTCAATGACGTCACCAAGGATGAGGCCTACGACCAGCTTCTGCTTCAGGCCCGAGCGCTGTTTG
CGGGCCAGCGCAATTGGGTTCGTGAGTGCCGGGCGGAGCTGCGAGGCGTCGATTGACAGCTCCAACGAGCAGGTT
TGCAACCTCGCCAACGCTGCCTCGTTGCTGTGGCACGCATACAAGGCGATGCCAGCTCCAAGCAATGCCGTGAAC
TGGGCAGGCTTCTACGTCATGGACCGCACCTCGTCGCAGCTACGACTCCTCCTCGGTCCCTTCCAGGGCAAGGTG
GCGTGCCAGAGCATCGAGCTGGGCCGCGGCGTCTGCGGCAGGGCGGCGGCATTAGGCGAGACGCAGGTGGTTGAG
GATGTGGGCGAGGACGCCGACCACATCGCCTGTGACAGCGCCACTAAGAGCGAGATTGTAGTGCCGGTAATGGTG
GGCGCGAGCGGACGCGACGTCGTCGCCGTCATCGACGTCGACTGCGCGGCGAAACGCGGCTTTGACGAGTGCGAC
AAGCGGAAGCTTCAGCGGCTGGCCGAGCTGTTGGCCGAAGGCTGTGACTGG
Transcript >Ophio5|2880
ATGCTGATTTCGTCAATGACGTCACCAAGGATGAGGCCTACGACCAGCTTCTGCTTCAGGCCCGAGCGCTGTTTG
CGGGCCAGCGCAATTGGGTTCGTGAGTGCCGGGCGGAGCTGCGAGGCGTCGATTGACAGCTCCAACGAGCAGGTT
TGCAACCTCGCCAACGCTGCCTCGTTGCTGTGGCACGCATACAAGGCGATGCCAGCTCCAAGCAATGCCGTGAAC
TGGGCAGGCTTCTACGTCATGGACCGCACCTCGTCGCAGCTACGACTCCTCCTCGGTCCCTTCCAGGGCAAGGTG
GCGTGCCAGAGCATCGAGCTGGGCCGCGGCGTCTGCGGCAGGGCGGCGGCATTAGGCGAGACGCAGGTGGTTGAG
GATGTGGGCGAGGACGCCGACCACATCGCCTGTGACAGCGCCACTAAGAGCGAGATTGTAGTGCCGGTAATGGTG
GGCGCGAGCGGACGCGACGTCGTCGCCGTCATCGACGTCGACTGCGCGGCGAAACGCGGCTTTGACGAGTGCGAC
AAGCGGAAGCTTCAGCGGCTGGCCGAGCTGTTGGCCGAAGGCTGTGACTGGTGA
Gene >Ophio5|2880
ATGGTCTGTCATATCATTGGTGACCTCCACAAGTCTGCTGACTCGAGACTTGGAGGTTCACGCCGACGCAGCTGA
TTTCGTCAATGACGTCACCAAGGATGAGGCCTACGACCAGCTTCTGCTTCAGGCCCGAGCGCTGTTTGCGGGCCA
GCGCAATTGGGTTCGTGAGTGCCGGGCGGAGCTGCGAGGCGTCGATTGACAGCTCCAACGAGCAGGTTTGGTATG
CGGCTCCACCAGACGAGGTCGAGACGCGACAGTAGGTAACCGCCATGTAGCAACCTCGCCAACGCTGCCTCGTTG
CTGTGGCACGCATACAAGGCGATGCCAGCTCCAAGCAATGCCGTGAACTGGGCAGGCAAGTGTGGTACAATGGAT
ATGTGATCAAATCACGAACCCGGTGCTGAGCGCTGAGCAGGCTTCTACGTCATGGACCGCACCTCGTCGCAGCTA
CGACTCCTCCTCGGTCCCTTCCAGGGCAAGGTGGCGTGCCAGAGCATCGAGCTGGGCCGCGGCGTCTGCGGCAGG
GCGGCGGCATTAGGCGAGACGCAGGTGGTTGAGGATGTGGGCGAGGACGCCGACCACATCGCCTGTGACAGCGCC
ACTAAGAGCGAGATTGTAGTGCCGGTAATGGTGGGCGCGAGCGGACGCGACGTCGTCGCCGTCATCGACGTCGAC
TGCGCGGCGAAACGCGGCTTTGACGAGTGCGACAAGCGGAAGCTTCAGCGGCTGGCCGAGCTGTTGGCCGAAGGC
TGTGACTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail