Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2876
Gene name
Locationscaffold_23:48744..50207
Strand+
Gene length (bp)1463
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03060 NMO Nitronate monooxygenase 2.6E-25 127 322
PF01070 FMN_dh FMN-dependent dehydrogenase 5.2E-09 101 220
PF01645 Glu_synthase Conserved region in glutamate synthase 2.3E-05 114 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01284|2NPD_NEUCR Nitronate monooxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ncd-2 PE=1 SV=1 3 324 7.0E-81
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 13 238 9.0E-13
sp|Q6GIG7|2NPD_STAAR Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0883 PE=3 SV=1 13 246 2.0E-11
sp|Q6GB05|2NPD_STAAS Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0791 PE=3 SV=1 13 246 2.0E-11
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 13 246 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01284|2NPD_NEUCR Nitronate monooxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ncd-2 PE=1 SV=1 3 324 7.0E-81
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 13 238 9.0E-13
sp|Q6GIG7|2NPD_STAAR Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0883 PE=3 SV=1 13 246 2.0E-11
sp|Q6GB05|2NPD_STAAS Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0791 PE=3 SV=1 13 246 2.0E-11
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 13 246 2.0E-11
sp|A5IR97|2NPD_STAA9 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1 13 246 2.0E-11
sp|A6U025|2NPD_STAA2 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_0937 PE=3 SV=1 13 246 2.0E-11
sp|O05413|2NPD_BACSU Probable nitronate monooxygenase OS=Bacillus subtilis (strain 168) GN=yrpB PE=3 SV=1 134 244 3.0E-11
sp|A8Z1H7|2NPD_STAAT Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_0879 PE=3 SV=1 13 246 3.0E-11
sp|A6QFD2|2NPD_STAAE Probable nitronate monooxygenase OS=Staphylococcus aureus (strain Newman) GN=NWMN_0792 PE=3 SV=1 13 246 3.0E-11
sp|Q5HHG4|2NPD_STAAC Probable nitronate monooxygenase OS=Staphylococcus aureus (strain COL) GN=SACOL0922 PE=3 SV=1 13 246 3.0E-11
sp|Q2FZX9|2NPD_STAA8 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00855 PE=3 SV=1 13 246 3.0E-11
sp|Q2FIF3|2NPD_STAA3 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0825 PE=3 SV=1 13 246 3.0E-11
sp|Q8NXG7|2NPD_STAAW Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MW2) GN=MW0803 PE=3 SV=1 13 246 8.0E-11
sp|Q4L4T4|2NPD_STAHJ Probable nitronate monooxygenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2032 PE=3 SV=1 131 238 8.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0015930 glutamate synthase activity Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0006537 glutamate biosynthetic process Yes
GO:0018580 nitronate monooxygenase activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:0016703 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases) No
GO:1901576 organic substance biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0008652 cellular amino acid biosynthetic process No
GO:0008150 biological_process No
GO:0006520 cellular amino acid metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0003824 catalytic activity No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0003674 molecular_function No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0004497 monooxygenase activity No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2876
MSLTKWFPWTASPVICNGPMLGAATPALATEVSKAGGIGFLASIFDLSKGSAQLSALDTELSESEPSRIGISFIT
GDASAALFSQTALPIIAKHRPAAVWLFAQAERTRLHLAFIRALRNLDPAPRVFVQIGNVEAAREAASDGAHVLVC
QGIDAGGHQFRRGAGVISLVPEVCEMLKNEFPDRQVAVLAAGGIVDERGVVAAMALGADGVVMGTRFTVARESVY
PEHRKQQILQTADGAVSTLKAPFHDEIKSSALWGPLYDGRAIIGPVHLQFMSGSSLDECKKMLQENYSTDEATQM
LSTWAGTGVGLVKRQQPAGEVVVETDVHVGIRTTPASLPMHCRRYKYRAHDAD
Coding >Ophio5|2876
ATGTCTCTGACCAAGTGGTTCCCATGGACGGCCTCCCCCGTGATATGCAACGGGCCTATGCTGGGCGCAGCAACT
CCCGCTCTGGCTACTGAGGTCTCAAAGGCCGGCGGCATTGGCTTCCTCGCCTCCATTTTCGACTTGTCTAAGGGC
TCGGCCCAGCTGAGCGCTCTGGATACAGAGCTGTCTGAGAGTGAACCGTCGCGCATCGGCATCAGCTTCATCACC
GGCGACGCCTCGGCTGCCCTCTTCTCACAGACGGCGCTTCCCATCATTGCCAAGCATCGTCCGGCTGCTGTCTGG
CTCTTTGCGCAAGCCGAGCGCACACGGCTGCACCTGGCCTTCATCCGCGCTCTCAGGAACTTGGATCCGGCGCCG
CGTGTCTTCGTTCAGATCGGCAACGTCGAGGCCGCGAGGGAGGCCGCCTCCGACGGGGCCCATGTACTGGTTTGT
CAGGGCATCGATGCCGGCGGCCATCAATTCCGTCGGGGAGCCGGTGTCATCTCTCTGGTGCCAGAGGTCTGCGAG
ATGCTCAAGAACGAGTTTCCCGATCGCCAAGTAGCCGTCCTCGCTGCCGGTGGCATCGTCGACGAACGGGGAGTT
GTCGCTGCCATGGCACTTGGGGCCGACGGCGTCGTTATGGGCACTCGGTTCACCGTGGCCAGAGAATCCGTCTAT
CCCGAGCATCGAAAACAGCAAATCCTGCAGACTGCGGACGGAGCCGTTTCCACGCTCAAAGCGCCATTCCACGAC
GAGATCAAGAGCTCGGCTCTCTGGGGTCCCCTGTATGACGGCCGCGCCATCATAGGCCCCGTGCACCTTCAATTC
ATGTCTGGTTCGTCCCTGGACGAGTGCAAGAAGATGCTGCAAGAGAATTACTCCACCGACGAGGCAACCCAGATG
CTCAGCACGTGGGCAGGTACGGGCGTGGGTCTCGTTAAGCGGCAACAGCCAGCGGGCGAGGTCGTCGTCGAGACA
GATGTGCATGTTGGAATACGAACAACGCCGGCGAGCCTTCCCATGCATTGCCGTCGGTACAAGTACAGAGCCCAC
GACGCCGAC
Transcript >Ophio5|2876
ATGTCTCTGACCAAGTGGTTCCCATGGACGGCCTCCCCCGTGATATGCAACGGGCCTATGCTGGGCGCAGCAACT
CCCGCTCTGGCTACTGAGGTCTCAAAGGCCGGCGGCATTGGCTTCCTCGCCTCCATTTTCGACTTGTCTAAGGGC
TCGGCCCAGCTGAGCGCTCTGGATACAGAGCTGTCTGAGAGTGAACCGTCGCGCATCGGCATCAGCTTCATCACC
GGCGACGCCTCGGCTGCCCTCTTCTCACAGACGGCGCTTCCCATCATTGCCAAGCATCGTCCGGCTGCTGTCTGG
CTCTTTGCGCAAGCCGAGCGCACACGGCTGCACCTGGCCTTCATCCGCGCTCTCAGGAACTTGGATCCGGCGCCG
CGTGTCTTCGTTCAGATCGGCAACGTCGAGGCCGCGAGGGAGGCCGCCTCCGACGGGGCCCATGTACTGGTTTGT
CAGGGCATCGATGCCGGCGGCCATCAATTCCGTCGGGGAGCCGGTGTCATCTCTCTGGTGCCAGAGGTCTGCGAG
ATGCTCAAGAACGAGTTTCCCGATCGCCAAGTAGCCGTCCTCGCTGCCGGTGGCATCGTCGACGAACGGGGAGTT
GTCGCTGCCATGGCACTTGGGGCCGACGGCGTCGTTATGGGCACTCGGTTCACCGTGGCCAGAGAATCCGTCTAT
CCCGAGCATCGAAAACAGCAAATCCTGCAGACTGCGGACGGAGCCGTTTCCACGCTCAAAGCGCCATTCCACGAC
GAGATCAAGAGCTCGGCTCTCTGGGGTCCCCTGTATGACGGCCGCGCCATCATAGGCCCCGTGCACCTTCAATTC
ATGTCTGGTTCGTCCCTGGACGAGTGCAAGAAGATGCTGCAAGAGAATTACTCCACCGACGAGGCAACCCAGATG
CTCAGCACGTGGGCAGGTACGGGCGTGGGTCTCGTTAAGCGGCAACAGCCAGCGGGCGAGGTCGTCGTCGAGACA
GATGTGCATGTTGGAATACGAACAACGCCGGCGAGCCTTCCCATGCATTGCCGTCGGTACAAGTACAGAGCCCAC
GACGCCGACTAG
Gene >Ophio5|2876
ATGTCTCTGACCAAGTGGTTCCCATGGACGGCCTCCCCCGTGATATGCAACGGGCCTATGCTGGGCGCAGCAACT
CCCGCTCTGGCTGTAACTAACTGCCTACCTCCGAAGCCTCGACCCCCAGAGGCAGACATGACTGACGAGAGCAGA
CTGAGGTCTCAAAGGCCGGCGGCATTGGCTTCCTCGCCTCCATTTTCGACTTGTCTAAGGGCTCGGCCCAGCTGA
GCGCTCTGGATACAGAGCTGTCTGAGAGTGAACCGTCGCGCATCGGCATCAGCTTCATCACCGGCGACGCCTCGG
CTGCCCTCTTCTCACAGACGGCGCTTCCCATCATTGCCAAGCATCGTCCGGCTGCTGTCTGGCTCTTTGCGCAAG
CCGAGCGCACACGGCTGCACCTGGCCTTCATCCGCGCTCTCAGGAACTTGGATCCGGCGCCGCGTGTCTTCGTTC
AGATCGGCAACGTCGAGGCCGCGAGGGAGGCCGCCTCCGACGGGGCCCATGTACTGGTTTGTCAGGGCATCGATG
CCGGCGGTATGGGACGCGGTCTACTGGTAGTTGCTGTCGACGCTGAACGAGCAAATAGGCCATCAATTCCGTCGG
GGAGCCGGTGTCATCTCTCTGGTGCCAGAGGTCTGCGAGATGCTCAAGAACGAGTTTCCCGATCGCCAAGTAGCC
GTCCTCGCTGCCGGTGGCATCGTCGACGAACGGGGAGTTGTCGCTGCCATGGCACTTGGTGAAAAGGAGCCTCCT
CTCAATCATCTAGAGACTTTGGCTGATATTTGATTGCAGGGGCCGACGGCGTCGTTATGGGCACTCGGGTTTCAA
CCCTTGCATTGACCTTCTGTTAATCTGGCTGCTAATGATCTTCGTACAGTTCACCGTGGCCAGAGAATCCGTCTA
TCCCGAGCATCGAAAACAGCAAATCCTGCAGACTGCGGACGGAGCCGTTTCCACGCTCAAGTTGGCCACCGCGAT
CCTGTCTCCGGAGCCAGGCTAATACCCGCTGTCGTTATTAGAGCGCCATTCCACGACGAGATCAAGAGCTCGGCT
CTCTGGGGTCCCCTGTATGACGGCCGCGCCATCATAGGCCCCGTGCACCTTCAATTCATGTCTGGTTCGTCCCTG
GACGAGTGCAAGAAGATGCTGCAAGAGAATTACTCCACCGACGAGGCAACCCAGATGCTCAGCACGTGGGCGTAA
GTGGCCATACAGCCTGCTAGGCTGTGGCATCCTAGGCTCATTATGCTACAGAGGTACGGGCGTGGGTCTCGTTAA
GCGGCAACAGCCAGCGGGCGAGGTCGTCGTCGAGGTGCGCGAAGGCGCAAAGGAACACATTAGGAGGCTGGCCGG
GCTTGTCTAAGATTTCCAACCAGACAGATGTGCATGTTGGAATACGAACAACGCCGGCGAGCCTTCCCATGCATT
GCCGTCGGTACAAGTACAGAGCCCACGACGCCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail