Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|287
Gene name
Locationscaffold_106:28886..30152
Strand-
Gene length (bp)1266
Transcript length (bp)1206
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01263 Aldose_epim Aldose 1-epimerase 1.5E-43 29 366

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AMB9|GALM_ARTBC Probable aldose 1-epimerase ARB_05372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05372 PE=1 SV=1 27 387 3.0E-82
sp|Q9GKX6|GALM_PIG Aldose 1-epimerase OS=Sus scrofa GN=GALM PE=2 SV=1 9 365 8.0E-37
sp|Q96C23|GALM_HUMAN Aldose 1-epimerase OS=Homo sapiens GN=GALM PE=1 SV=1 26 365 2.0E-36
sp|Q5R8U1|GALM_PONAB Aldose 1-epimerase OS=Pongo abelii GN=GALM PE=2 SV=1 26 365 1.0E-35
sp|Q5EA79|GALM_BOVIN Aldose 1-epimerase OS=Bos taurus GN=GALM PE=2 SV=1 26 365 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AMB9|GALM_ARTBC Probable aldose 1-epimerase ARB_05372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05372 PE=1 SV=1 27 387 3.0E-82
sp|Q9GKX6|GALM_PIG Aldose 1-epimerase OS=Sus scrofa GN=GALM PE=2 SV=1 9 365 8.0E-37
sp|Q96C23|GALM_HUMAN Aldose 1-epimerase OS=Homo sapiens GN=GALM PE=1 SV=1 26 365 2.0E-36
sp|Q5R8U1|GALM_PONAB Aldose 1-epimerase OS=Pongo abelii GN=GALM PE=2 SV=1 26 365 1.0E-35
sp|Q5EA79|GALM_BOVIN Aldose 1-epimerase OS=Bos taurus GN=GALM PE=2 SV=1 26 365 4.0E-35
sp|Q66HG4|GALM_RAT Aldose 1-epimerase OS=Rattus norvegicus GN=Galm PE=1 SV=1 26 365 4.0E-34
sp|Q8K157|GALM_MOUSE Aldose 1-epimerase OS=Mus musculus GN=Galm PE=1 SV=1 26 365 4.0E-34
sp|P05149|GALM_ACICA Aldose 1-epimerase OS=Acinetobacter calcoaceticus GN=mro PE=1 SV=1 1 365 2.0E-27
sp|P0A9C4|GALM_SHIFL Aldose 1-epimerase OS=Shigella flexneri GN=galM PE=3 SV=1 33 386 3.0E-25
sp|P0A9C3|GALM_ECOLI Aldose 1-epimerase OS=Escherichia coli (strain K12) GN=galM PE=1 SV=1 33 386 3.0E-25
sp|P31765|GALM_HAEIN Aldose 1-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galM PE=3 SV=2 78 387 5.0E-20
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 34 397 1.0E-19
sp|Q03PA4|MALEP_LACBA Maltose epimerase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=LVIS_1908 PE=1 SV=1 33 389 1.0E-15
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 31 387 8.0E-14
sp|P40801|GAL10_PACTA Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1 41 387 1.0E-13
sp|P21955|GALM_STRTR Aldose 1-epimerase OS=Streptococcus thermophilus GN=galM PE=3 SV=1 30 363 1.0E-12
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 31 386 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016853 isomerase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|287
MKTHAWLWLTLSLASSASAAADRDGKYWIHGDGLSAAFVPYGASISNLVFSDQHGVKRDLVVGFDNASYYSVDKS
HPHLGGVPGRYANRIKNSSFVIDGKQYNVLANENPQPASPKGVDTLHGGPDGWDWRNFTVVSHTPSAVVFSLFDP
AGKEGFPGEVVSLISYALKGRDWDISMVAMATTAKTPIMLSSHTYWNLDGFSNDATRSALNHSLHLPYSGQRIGV
DSILVPTGEILPNAPGSVNDFWSKPREIGSAWGDAALNGNCGENCTGYDNCYTINRGPSGSFDWRTSGPVATLSS
DWSGIQLDIFTDQEAMQLYSCNGQNGTLALKKTQGTSGFPRTIPKYGCVVLEVQDYIDGINHPEWMRKQVYGPSD
GPYVLQAKYRFSLKSEHEAKAKGGDP
Coding >Ophio5|287
ATGAAGACGCACGCCTGGCTGTGGCTGACTCTGTCGTTGGCTTCGTCGGCTTCGGCGGCAGCAGACCGGGACGGC
AAGTATTGGATCCACGGCGACGGCCTGTCTGCAGCCTTCGTTCCGTACGGAGCGTCCATCTCCAACCTGGTATTC
AGCGACCAGCACGGGGTCAAGCGCGATCTAGTCGTCGGCTTCGACAACGCCAGCTACTACAGCGTCGATAAGTCG
CATCCGCACCTGGGAGGCGTTCCCGGCCGGTACGCGAATCGCATCAAGAACAGCTCCTTCGTCATCGACGGGAAG
CAGTACAATGTGCTGGCCAACGAGAATCCGCAGCCGGCATCACCCAAGGGTGTGGACACGCTTCATGGCGGACCC
GACGGCTGGGACTGGCGCAACTTCACCGTCGTCTCCCACACGCCCTCCGCTGTCGTCTTCTCGCTCTTCGATCCG
GCTGGCAAGGAGGGCTTTCCCGGTGAGGTGGTGTCGCTGATCAGCTATGCACTGAAGGGGAGGGATTGGGATATC
AGCATGGTGGCTATGGCGACGACGGCCAAGACGCCCATCATGCTGAGCAGCCATACCTACTGGAACCTCGACGGC
TTTTCCAATGACGCGACTCGCTCGGCCCTCAATCATTCGCTGCATCTTCCCTATAGCGGGCAGCGCATCGGCGTG
GACAGCATCCTCGTGCCGACGGGCGAGATCCTGCCCAACGCTCCCGGCTCCGTCAACGATTTCTGGAGCAAGCCG
CGTGAGATAGGGTCTGCTTGGGGAGACGCCGCGCTCAATGGCAACTGCGGCGAAAACTGCACCGGTTACGACAAC
TGCTACACCATCAACCGCGGCCCCAGCGGCAGCTTCGACTGGCGTACCAGCGGTCCCGTAGCCACGCTGTCATCG
GACTGGTCCGGCATCCAGCTCGACATCTTCACCGACCAGGAAGCCATGCAGCTGTACTCGTGCAACGGCCAGAAC
GGCACCCTGGCGCTGAAGAAGACGCAGGGCACCTCCGGCTTTCCTCGGACGATTCCCAAGTATGGCTGCGTCGTG
CTCGAGGTGCAGGATTATATCGATGGCATCAATCACCCTGAGTGGATGCGGAAGCAGGTGTATGGCCCGTCGGAT
GGGCCGTATGTGCTGCAGGCCAAGTATCGCTTCAGCCTCAAGTCGGAGCACGAGGCCAAGGCCAAGGGCGGGGAT
CCG
Transcript >Ophio5|287
ATGAAGACGCACGCCTGGCTGTGGCTGACTCTGTCGTTGGCTTCGTCGGCTTCGGCGGCAGCAGACCGGGACGGC
AAGTATTGGATCCACGGCGACGGCCTGTCTGCAGCCTTCGTTCCGTACGGAGCGTCCATCTCCAACCTGGTATTC
AGCGACCAGCACGGGGTCAAGCGCGATCTAGTCGTCGGCTTCGACAACGCCAGCTACTACAGCGTCGATAAGTCG
CATCCGCACCTGGGAGGCGTTCCCGGCCGGTACGCGAATCGCATCAAGAACAGCTCCTTCGTCATCGACGGGAAG
CAGTACAATGTGCTGGCCAACGAGAATCCGCAGCCGGCATCACCCAAGGGTGTGGACACGCTTCATGGCGGACCC
GACGGCTGGGACTGGCGCAACTTCACCGTCGTCTCCCACACGCCCTCCGCTGTCGTCTTCTCGCTCTTCGATCCG
GCTGGCAAGGAGGGCTTTCCCGGTGAGGTGGTGTCGCTGATCAGCTATGCACTGAAGGGGAGGGATTGGGATATC
AGCATGGTGGCTATGGCGACGACGGCCAAGACGCCCATCATGCTGAGCAGCCATACCTACTGGAACCTCGACGGC
TTTTCCAATGACGCGACTCGCTCGGCCCTCAATCATTCGCTGCATCTTCCCTATAGCGGGCAGCGCATCGGCGTG
GACAGCATCCTCGTGCCGACGGGCGAGATCCTGCCCAACGCTCCCGGCTCCGTCAACGATTTCTGGAGCAAGCCG
CGTGAGATAGGGTCTGCTTGGGGAGACGCCGCGCTCAATGGCAACTGCGGCGAAAACTGCACCGGTTACGACAAC
TGCTACACCATCAACCGCGGCCCCAGCGGCAGCTTCGACTGGCGTACCAGCGGTCCCGTAGCCACGCTGTCATCG
GACTGGTCCGGCATCCAGCTCGACATCTTCACCGACCAGGAAGCCATGCAGCTGTACTCGTGCAACGGCCAGAAC
GGCACCCTGGCGCTGAAGAAGACGCAGGGCACCTCCGGCTTTCCTCGGACGATTCCCAAGTATGGCTGCGTCGTG
CTCGAGGTGCAGGATTATATCGATGGCATCAATCACCCTGAGTGGATGCGGAAGCAGGTGTATGGCCCGTCGGAT
GGGCCGTATGTGCTGCAGGCCAAGTATCGCTTCAGCCTCAAGTCGGAGCACGAGGCCAAGGCCAAGGGCGGGGAT
CCGTAG
Gene >Ophio5|287
ATGAAGACGCACGCCTGGCTGTGGCTGACTCTGTCGTTGGCTTCGTCGGCTTCGGCGGCAGCAGACCGGGACGGC
AAGTATTGGATCCACGGCGACGGCCTGTCTGCAGCCTTCGTTCCGTACGGAGCGTCCATCTCCAACCTGGTATTC
AGCGACCAGCACGGGGTCAAGCGCGATCTAGTCGTCGGCTTCGACAACGCCAGCTACTACAGCGTCGATAAGTCG
CATCCGCACCTGGGAGGCGTTCCCGGCCGGTACGCGAATCGCATCAAGAACAGCTCCTTCGTCATCGACGGGAAG
CAGTACAATGTGCTGGCCAACGAGAATCCGCAGCCGGCATCACCCAAGGGTGTGGACACGCTTCATGGCGGACCC
GACGGCTGGGACTGGCGCAACTTCACCGTCGTCTCCCACACGCCCTCCGCTGTCGTCTTCTCGCTCTTCGATCCG
GCTGGCAAGGAGGGCTTTCCCGGTGAGGTGGTGTCGCTGATCAGCTATGCACTGAAGGGGAGGGATTGGGATATC
AGCATGGTGGCTATGGCGACGACGGCCAAGACGCCCATCATGCTGAGCAGCCATACCTACTGGAACCTCGACGGC
TTTTCCAATGACGCGACTCGCTCGGCCCTCAATCATTCGCTGCATCTTCCCTATAGCGGGCAGCGCATCGGCGTG
GACAGCATCCTCGTGCCGACGGGCGAGATCCTGCCCAACGCTCCCGGCTCCGTCAACGATTTCTGGAGCAAGCCG
CGTGAGATAGGGTCTGCTTGGGGAGACGCCGCGCTCAATGGCAACTGCGGCGAAAACTGCACCGGTTACGGTGAG
TTTTTTCCCCTTGCCTCTTGGTCAGGCACGGACAGGTGGCTGATGTATCAAGCAGACAACTGCTACACCATCAAC
CGCGGCCCCAGCGGCAGCTTCGACTGGCGTACCAGCGGTCCCGTAGCCACGCTGTCATCGGACTGGTCCGGCATC
CAGCTCGACATCTTCACCGACCAGGAAGCCATGCAGCTGTACTCGTGCAACGGCCAGAACGGCACCCTGGCGCTG
AAGAAGACGCAGGGCACCTCCGGCTTTCCTCGGACGATTCCCAAGTATGGCTGCGTCGTGCTCGAGGTGCAGGAT
TATATCGATGGCATCAATCACCCTGAGTGGATGCGGAAGCAGGTGTATGGCCCGTCGGATGGGCCGTATGTGCTG
CAGGCCAAGTATCGCTTCAGCCTCAAGTCGGAGCACGAGGCCAAGGCCAAGGGCGGGGATCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail