Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2864
Gene name
Locationscaffold_23:15297..19555
Strand-
Gene length (bp)4258
Transcript length (bp)3861
Coding sequence length (bp)3858
Protein length (aa) 1286

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 1.8E-16 914 992
PF01822 WSC WSC domain 4.5E-17 1037 1115
PF01822 WSC WSC domain 1.8E-18 1187 1265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 995 1265 4.0E-26
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1038 1265 5.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1037 1265 4.0E-24
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 912 1269 1.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 805 1122 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 995 1265 4.0E-26
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1038 1265 5.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1037 1265 4.0E-24
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 912 1269 1.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 805 1122 6.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 912 1123 3.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1185 1267 6.0E-14
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 876 1245 1.0E-13
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 914 1123 2.0E-13
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 910 1123 4.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 913 1123 8.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1037 1131 1.0E-10
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 1013 1166 2.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 1013 1166 2.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 913 1136 3.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 875 1086 5.0E-10
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 1037 1131 2.0E-09
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1177 1261 2.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 1020 1163 4.0E-09
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 914 1086 1.0E-08
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 914 1086 2.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 1036 1153 3.0E-08
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 1037 1142 3.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 1035 1153 4.0E-08
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 1037 1124 3.0E-07
sp|Q90Y90|KREM1_XENLA Kremen protein 1 OS=Xenopus laevis GN=kremen1 PE=2 SV=1 1036 1122 6.0E-07
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 915 992 2.0E-06
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1183 1286 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2864
MKSLLLLALVGLVDALALTDTITWGGDGSRAGYQPNHNMDPAIVASPQFGQLFGTLLPGSFAGQPEQIYSQPLVY
TPVGGRQFVYVATTLNNIYKLDAKSGAILASRNLHVPFLTADLDGCNDINPAVGIIATGTIDPTTDTLYLTAKTY
VDQTLGGRPQGRPAGRYYVHALDVNDLTERPNFPVDLQGILARNNPSRMFTGGIHLQRPALLLAGRYLYAGFASH
CVQYNFTGWIMGLDKSTGAIVERWSTQGAGVPDNIRGGGIWMSGGGLSYDGAGSIFLATGNGYASQLSTIPVRGY
NPPTSLEEAALHLTMNPDGSLNLVDFFMPWEKQAMDGADKDLGTSPLEILPAQFACGDVKRIGVVTAKTGKTYWL
NLDNLGGYRNGKDGLDDIIQSYQNENSVYSGAGVYPLEGGYLYINVIQYPTSVFKFSCNGGVPAFTKVAVSPASN
AYILGVGHGTVTSMADQPGSALLWVTDVQGPGVRVYNAVPKDGTLVSVNSFNVPGVTKFSRAVFGDAIMYVGTTT
GYIYGFGSPVNSPLNCTSPLDFGIVDIKATSDTRAMVCRAVVDLTITGLGLADGKNFALSDSPKLPLQLAQGQSF
PVNAKFSPSTVGLLSVNLVVNTTNGVTGFSTNTHARLVGTGRSAGPLLAVSPNTVSFPGVIAGHDPNGVSETVVV
SNRGNAALTIRSILHSADNSTALEPYDGQGDLVVGRFTLQKIPTLVAANAGSAINVLFNSSVSGTFSALIRFITD
GGNGSVTIYASSGPAPVALLEFQTIDGLDWVKYEPGTPFSFGNVTENTSRSLKFRITNAAPAGGVKLSLTVSKPP
FGVSGLIKAVNQVDLAEGTSFAPGESATAVLTCTAPKSQWNVDPYNGTSQWTLNTNDAVLGKQFVHFSCSALAEQ
APPLLLGGKGQYRYVGCFKDNTPDRQLPIQVVADDNLTNAMCIAACAQSKYVFCGTEYLRECWAGNQIPMQKVDE
ENCNYNCAGAINQICGGNGVNEGAGGAYISLFADSLRWDGNLTRPPPPGPVVNPGVAGFASIGCYTEGNPDRALP
NGVNTNKRTVAACVNACKAATFSIAGVEYGGECWCGNAMGRGSVPAPAADCVMTCNDNSTEYCGGPSRLNIYRLG
APSSSSSSSSFSSSAGVGTPSNAASSSRSSSFIPASTTASSSFPTPTPTGPAIKKAVGRYSFQGCWTEATNGRAL
SGNSYADDRMTLEFCAAFCNGFRYFATEYGRECFCGNSLGDGSNRAENQNDCSFSCPGDASEFCGAGDLTPEGRC
GVVTYEEKQES
Coding >Ophio5|2864
ATGAAGTCTCTCCTGCTGTTGGCCCTTGTCGGTCTCGTCGATGCCCTCGCTTTGACAGACACCATCACCTGGGGC
GGTGATGGCTCCCGAGCCGGATACCAGCCAAACCACAACATGGATCCGGCCATCGTCGCCAGTCCCCAGTTCGGC
CAGCTGTTTGGCACCTTGCTGCCAGGCTCTTTCGCCGGTCAACCGGAGCAAATCTACTCGCAGCCTCTCGTCTAC
ACCCCTGTCGGGGGTCGCCAGTTCGTCTACGTTGCCACGACGCTCAACAACATCTATAAGCTGGATGCCAAGTCT
GGCGCCATCCTTGCCTCGCGGAACCTTCACGTACCCTTCCTCACGGCAGACTTGGATGGCTGTAACGACATCAAC
CCGGCTGTGGGAATCATTGCAACCGGCACTATCGATCCGACCACCGATACCCTCTATCTCACAGCCAAGACGTAT
GTCGACCAAACGCTTGGCGGCAGACCCCAGGGCAGGCCTGCTGGTCGCTATTATGTTCACGCCCTGGATGTAAAC
GACCTAACGGAGCGTCCCAACTTCCCCGTTGACTTACAAGGCATCCTCGCCAGAAATAACCCTTCTCGCATGTTC
ACCGGCGGCATCCACCTTCAACGGCCTGCCCTGTTGCTCGCCGGCCGATACCTCTACGCCGGCTTCGCCTCTCAC
TGTGTTCAGTACAACTTTACCGGTTGGATCATGGGCTTGGACAAGTCCACCGGCGCCATCGTCGAACGATGGTCT
ACCCAGGGTGCGGGTGTGCCCGACAATATCAGGGGAGGCGGCATCTGGATGTCCGGCGGCGGCCTCTCCTACGAC
GGCGCCGGCTCTATTTTCCTCGCCACCGGCAACGGTTATGCCAGCCAGCTCAGCACGATTCCCGTTAGGGGCTAC
AACCCGCCAACCTCGCTGGAGGAGGCCGCGCTGCATCTCACCATGAACCCAGACGGTAGCTTAAATCTGGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCCATGGACGGCGCCGACAAGGACCTCGGCACCAGCCCTCTCGAGATTTTG
CCGGCTCAATTTGCCTGCGGCGACGTCAAACGCATCGGCGTCGTCACGGCAAAGACCGGAAAGACGTACTGGCTG
AACCTCGATAACTTGGGCGGCTACAGAAACGGAAAGGATGGCTTGGACGACATCATCCAGTCCTACCAGAACGAA
AACTCCGTCTACAGCGGTGCCGGGGTCTACCCGCTCGAGGGTGGTTACCTTTACATCAACGTCATTCAGTATCCG
ACTTCCGTCTTCAAGTTCTCCTGCAACGGCGGCGTCCCCGCCTTCACAAAGGTCGCCGTCTCGCCCGCCTCCAAC
GCCTACATTCTCGGCGTGGGCCACGGAACCGTCACCTCCATGGCAGACCAGCCGGGCAGTGCTCTCCTGTGGGTC
ACCGACGTGCAGGGACCGGGCGTTCGCGTCTACAACGCCGTGCCCAAGGACGGAACCCTCGTCAGCGTCAACTCG
TTCAACGTCCCTGGTGTCACCAAGTTTTCCCGTGCCGTCTTTGGCGACGCAATCATGTATGTTGGGACGACGACT
GGCTACATCTACGGCTTCGGGTCACCGGTCAACTCCCCTTTGAACTGCACCTCGCCGCTGGACTTTGGGATCGTC
GATATCAAGGCCACCAGCGACACCAGAGCCATGGTCTGCCGAGCCGTTGTCGACCTCACTATCACCGGTCTTGGG
CTGGCCGATGGCAAGAACTTTGCCCTCTCGGACTCGCCAAAACTGCCCTTGCAGCTAGCTCAGGGGCAGTCGTTT
CCCGTGAACGCCAAGTTCAGCCCTTCGACCGTCGGCCTCCTCTCGGTCAACCTCGTCGTCAACACGACCAACGGC
GTCACTGGCTTTAGCACCAACACACATGCGCGGCTGGTTGGGACCGGTCGCAGCGCCGGCCCGCTCTTGGCCGTC
AGCCCCAACACCGTCTCGTTTCCCGGCGTCATCGCCGGGCATGATCCGAACGGCGTATCAGAGACGGTCGTGGTT
TCCAACAGGGGCAATGCTGCTCTGACCATTAGATCGATCCTGCATTCCGCCGACAACTCGACCGCGCTTGAACCT
TACGACGGTCAGGGCGACCTTGTTGTAGGACGATTTACGCTCCAGAAGATACCGACGTTAGTCGCCGCCAACGCT
GGAAGCGCCATCAACGTGCTCTTTAACTCGTCCGTCAGTGGCACGTTTTCTGCCTTGATCAGGTTCATTACCGAC
GGCGGCAACGGTAGCGTCACCATCTACGCATCGTCCGGGCCGGCTCCAGTGGCCCTCCTCGAGTTTCAGACCATC
GACGGCCTGGACTGGGTCAAATATGAGCCAGGTACTCCGTTTAGTTTCGGCAACGTTACCGAGAATACGTCAAGA
TCTCTCAAATTTCGCATCACCAATGCCGCGCCGGCCGGCGGGGTCAAACTGTCATTGACGGTGTCGAAGCCCCCT
TTTGGCGTCAGCGGCCTTATCAAGGCCGTCAACCAGGTCGATCTGGCCGAGGGCACTTCCTTTGCGCCTGGCGAG
AGTGCGACGGCGGTCCTGACCTGTACGGCGCCCAAATCTCAGTGGAACGTCGACCCCTATAACGGCACCTCCCAA
TGGACGCTGAACACAAACGACGCTGTGCTCGGCAAGCAATTCGTCCACTTCTCCTGCAGTGCCCTTGCCGAGCAG
GCACCTCCCCTACTGCTGGGTGGGAAGGGACAGTATCGTTACGTTGGCTGCTTCAAAGACAACACGCCCGACCGC
CAGCTCCCCATCCAGGTTGTCGCTGATGACAACCTCACCAATGCCATGTGCATTGCTGCGTGTGCACAGAGCAAG
TACGTCTTCTGTGGCACAGAGTACCTGCGCGAATGCTGGGCTGGCAACCAGATTCCCATGCAGAAGGTCGACGAA
GAAAACTGCAATTACAACTGTGCCGGCGCCATCAACCAGATATGTGGTGGGAACGGTGTCAACGAGGGGGCCGGC
GGGGCTTACATATCGCTCTTCGCCGACTCGCTCCGGTGGGACGGCAACCTAACCAGGCCGCCACCACCGGGGCCC
GTCGTCAATCCGGGGGTGGCGGGCTTCGCCAGCATAGGCTGTTACACGGAAGGCAATCCGGACCGGGCGCTGCCA
AACGGCGTCAACACAAACAAGAGGACGGTAGCTGCGTGTGTCAATGCCTGCAAGGCAGCGACCTTCTCCATTGCG
GGCGTTGAATACGGAGGCGAGTGCTGGTGTGGCAATGCGATGGGGCGCGGCTCGGTGCCTGCTCCTGCTGCGGAC
TGTGTGATGACGTGCAATGATAATTCGACCGAGTATTGCGGCGGGCCGTCGAGGCTTAATATTTACCGGCTGGGA
GCTCCGTCCAGCTCTTCCTCGTCGAGCTCTTTTTCCTCGTCAGCCGGCGTTGGCACACCCTCCAACGCCGCCTCC
TCGTCCAGGTCGTCTTCGTTCATCCCAGCATCCACAACGGCGAGCAGCAGCTTCCCGACACCAACTCCGACCGGA
CCAGCTATCAAGAAGGCGGTCGGAAGGTACAGCTTCCAGGGATGCTGGACGGAGGCGACCAACGGCCGAGCCCTC
AGCGGGAATTCGTACGCGGACGACAGGATGACGCTCGAATTTTGCGCAGCTTTCTGCAACGGGTTCAGATACTTT
GCCACCGAATACGGGCGGGAATGCTTCTGTGGCAACAGCCTCGGCGACGGTAGCAATAGGGCCGAGAACCAGAAT
GACTGTTCGTTTTCGTGTCCCGGCGATGCTTCTGAATTTTGCGGCGCAGGCGACTTGACGCCAGAGGGGCGTTGC
GGAGTAGTTACGTATGAAGAAAAGCAAGAATCC
Transcript >Ophio5|2864
ATGAAGTCTCTCCTGCTGTTGGCCCTTGTCGGTCTCGTCGATGCCCTCGCTTTGACAGACACCATCACCTGGGGC
GGTGATGGCTCCCGAGCCGGATACCAGCCAAACCACAACATGGATCCGGCCATCGTCGCCAGTCCCCAGTTCGGC
CAGCTGTTTGGCACCTTGCTGCCAGGCTCTTTCGCCGGTCAACCGGAGCAAATCTACTCGCAGCCTCTCGTCTAC
ACCCCTGTCGGGGGTCGCCAGTTCGTCTACGTTGCCACGACGCTCAACAACATCTATAAGCTGGATGCCAAGTCT
GGCGCCATCCTTGCCTCGCGGAACCTTCACGTACCCTTCCTCACGGCAGACTTGGATGGCTGTAACGACATCAAC
CCGGCTGTGGGAATCATTGCAACCGGCACTATCGATCCGACCACCGATACCCTCTATCTCACAGCCAAGACGTAT
GTCGACCAAACGCTTGGCGGCAGACCCCAGGGCAGGCCTGCTGGTCGCTATTATGTTCACGCCCTGGATGTAAAC
GACCTAACGGAGCGTCCCAACTTCCCCGTTGACTTACAAGGCATCCTCGCCAGAAATAACCCTTCTCGCATGTTC
ACCGGCGGCATCCACCTTCAACGGCCTGCCCTGTTGCTCGCCGGCCGATACCTCTACGCCGGCTTCGCCTCTCAC
TGTGTTCAGTACAACTTTACCGGTTGGATCATGGGCTTGGACAAGTCCACCGGCGCCATCGTCGAACGATGGTCT
ACCCAGGGTGCGGGTGTGCCCGACAATATCAGGGGAGGCGGCATCTGGATGTCCGGCGGCGGCCTCTCCTACGAC
GGCGCCGGCTCTATTTTCCTCGCCACCGGCAACGGTTATGCCAGCCAGCTCAGCACGATTCCCGTTAGGGGCTAC
AACCCGCCAACCTCGCTGGAGGAGGCCGCGCTGCATCTCACCATGAACCCAGACGGTAGCTTAAATCTGGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCCATGGACGGCGCCGACAAGGACCTCGGCACCAGCCCTCTCGAGATTTTG
CCGGCTCAATTTGCCTGCGGCGACGTCAAACGCATCGGCGTCGTCACGGCAAAGACCGGAAAGACGTACTGGCTG
AACCTCGATAACTTGGGCGGCTACAGAAACGGAAAGGATGGCTTGGACGACATCATCCAGTCCTACCAGAACGAA
AACTCCGTCTACAGCGGTGCCGGGGTCTACCCGCTCGAGGGTGGTTACCTTTACATCAACGTCATTCAGTATCCG
ACTTCCGTCTTCAAGTTCTCCTGCAACGGCGGCGTCCCCGCCTTCACAAAGGTCGCCGTCTCGCCCGCCTCCAAC
GCCTACATTCTCGGCGTGGGCCACGGAACCGTCACCTCCATGGCAGACCAGCCGGGCAGTGCTCTCCTGTGGGTC
ACCGACGTGCAGGGACCGGGCGTTCGCGTCTACAACGCCGTGCCCAAGGACGGAACCCTCGTCAGCGTCAACTCG
TTCAACGTCCCTGGTGTCACCAAGTTTTCCCGTGCCGTCTTTGGCGACGCAATCATGTATGTTGGGACGACGACT
GGCTACATCTACGGCTTCGGGTCACCGGTCAACTCCCCTTTGAACTGCACCTCGCCGCTGGACTTTGGGATCGTC
GATATCAAGGCCACCAGCGACACCAGAGCCATGGTCTGCCGAGCCGTTGTCGACCTCACTATCACCGGTCTTGGG
CTGGCCGATGGCAAGAACTTTGCCCTCTCGGACTCGCCAAAACTGCCCTTGCAGCTAGCTCAGGGGCAGTCGTTT
CCCGTGAACGCCAAGTTCAGCCCTTCGACCGTCGGCCTCCTCTCGGTCAACCTCGTCGTCAACACGACCAACGGC
GTCACTGGCTTTAGCACCAACACACATGCGCGGCTGGTTGGGACCGGTCGCAGCGCCGGCCCGCTCTTGGCCGTC
AGCCCCAACACCGTCTCGTTTCCCGGCGTCATCGCCGGGCATGATCCGAACGGCGTATCAGAGACGGTCGTGGTT
TCCAACAGGGGCAATGCTGCTCTGACCATTAGATCGATCCTGCATTCCGCCGACAACTCGACCGCGCTTGAACCT
TACGACGGTCAGGGCGACCTTGTTGTAGGACGATTTACGCTCCAGAAGATACCGACGTTAGTCGCCGCCAACGCT
GGAAGCGCCATCAACGTGCTCTTTAACTCGTCCGTCAGTGGCACGTTTTCTGCCTTGATCAGGTTCATTACCGAC
GGCGGCAACGGTAGCGTCACCATCTACGCATCGTCCGGGCCGGCTCCAGTGGCCCTCCTCGAGTTTCAGACCATC
GACGGCCTGGACTGGGTCAAATATGAGCCAGGTACTCCGTTTAGTTTCGGCAACGTTACCGAGAATACGTCAAGA
TCTCTCAAATTTCGCATCACCAATGCCGCGCCGGCCGGCGGGGTCAAACTGTCATTGACGGTGTCGAAGCCCCCT
TTTGGCGTCAGCGGCCTTATCAAGGCCGTCAACCAGGTCGATCTGGCCGAGGGCACTTCCTTTGCGCCTGGCGAG
AGTGCGACGGCGGTCCTGACCTGTACGGCGCCCAAATCTCAGTGGAACGTCGACCCCTATAACGGCACCTCCCAA
TGGACGCTGAACACAAACGACGCTGTGCTCGGCAAGCAATTCGTCCACTTCTCCTGCAGTGCCCTTGCCGAGCAG
GCACCTCCCCTACTGCTGGGTGGGAAGGGACAGTATCGTTACGTTGGCTGCTTCAAAGACAACACGCCCGACCGC
CAGCTCCCCATCCAGGTTGTCGCTGATGACAACCTCACCAATGCCATGTGCATTGCTGCGTGTGCACAGAGCAAG
TACGTCTTCTGTGGCACAGAGTACCTGCGCGAATGCTGGGCTGGCAACCAGATTCCCATGCAGAAGGTCGACGAA
GAAAACTGCAATTACAACTGTGCCGGCGCCATCAACCAGATATGTGGTGGGAACGGTGTCAACGAGGGGGCCGGC
GGGGCTTACATATCGCTCTTCGCCGACTCGCTCCGGTGGGACGGCAACCTAACCAGGCCGCCACCACCGGGGCCC
GTCGTCAATCCGGGGGTGGCGGGCTTCGCCAGCATAGGCTGTTACACGGAAGGCAATCCGGACCGGGCGCTGCCA
AACGGCGTCAACACAAACAAGAGGACGGTAGCTGCGTGTGTCAATGCCTGCAAGGCAGCGACCTTCTCCATTGCG
GGCGTTGAATACGGAGGCGAGTGCTGGTGTGGCAATGCGATGGGGCGCGGCTCGGTGCCTGCTCCTGCTGCGGAC
TGTGTGATGACGTGCAATGATAATTCGACCGAGTATTGCGGCGGGCCGTCGAGGCTTAATATTTACCGGCTGGGA
GCTCCGTCCAGCTCTTCCTCGTCGAGCTCTTTTTCCTCGTCAGCCGGCGTTGGCACACCCTCCAACGCCGCCTCC
TCGTCCAGGTCGTCTTCGTTCATCCCAGCATCCACAACGGCGAGCAGCAGCTTCCCGACACCAACTCCGACCGGA
CCAGCTATCAAGAAGGCGGTCGGAAGGTACAGCTTCCAGGGATGCTGGACGGAGGCGACCAACGGCCGAGCCCTC
AGCGGGAATTCGTACGCGGACGACAGGATGACGCTCGAATTTTGCGCAGCTTTCTGCAACGGGTTCAGATACTTT
GCCACCGAATACGGGCGGGAATGCTTCTGTGGCAACAGCCTCGGCGACGGTAGCAATAGGGCCGAGAACCAGAAT
GACTGTTCGTTTTCGTGTCCCGGCGATGCTTCTGAATTTTGCGGCGCAGGCGACTTGACGCCAGAGGGGCGTTGC
GGAGTAGTTACGTATGAAGAAAAGCAAGAATCCTAA
Gene >Ophio5|2864
ATGAAGTCTCTCCTGCTGTTGGCCCTTGTCGGTCTCGTCGATGCCCTCGCTTTGACAGACACCATCACCTGGGGC
GGTGATGGCTCCCGAGCCGGATACCAGCCGTACGAAGTATCTTCTGCCTTGCACTCCTTCCCTCATCTTGCTGAT
ATATCGCCGTCAAGAAACCACAACATGGATCCGGCCATCGTCGCCAGTCCCCAGTTCGGCCAGCTGTTTGGCACC
TTGCTGCCAGGCTCTTTCGCCGGTCAACCGGAGCAAATCTACTCGCAGCCTCTCGTCTACACCCCTGTCGGGGGT
CGCCAGTTCGTCTACGTTGCCACGACGCTCAACAACATCTATAAGCTGGATGCCAAGTCTGGCGCCATCCTTGCC
TCGCGGAACCTTCACGTACCCTTCCTCACGGCAGACTTGGATGGCTGTAACGACATCAACCCGGCTGTGGGAATC
ATTGCAACCGGCACTATCGATCCGACCACCGATACCCTCTATCTCACAGCCAAGACGTATGTCGACCAAACGCTT
GGCGGCAGACCCCAGGGCAGGCCTGCTGGTCGCTATTATGTTCACGCCCTGGATGTAAACGACCTAACGGAGCGT
CCCAACTTCCCCGTTGACTTACAAGGCATCCTCGCCAGAAATAACCCTTCTCGCATGTTCACCGGCGGCATCCAC
CTTCAACGGCCTGCCCTGTTGCTCGCCGGCCGATACCTCTACGCCGGCTTCGCCTCTCACTGTGTTCAGTACAAC
TTTACCGGTTGGATCATGGGCTTGGACAAGTCCACCGGCGCCATCGTCGAACGATGGTCTACCCAGGGTGCGGGT
GTGCCCGACAATATCAGGGGAGGCGGCATCTGGATGTCCGGCGGCGGCCTCTCCTACGACGGCGCCGGCTCTATT
TTCCTCGCCACCGGCAACGGTTATGCCAGCCAGCTCAGCACGATTCCCGTTAGGGGCTACAACCCGCCAACCTCG
CTGGAGGAGGCCGCGCTGCATCTCACCATGAACCCAGACGGTAGCTTAAATCTGGTCGACTTCTTCATGCCCTGG
GAGAAGCAGGCCATGGACGGCGCCGACAAGGACCTCGGCACCAGCCCTCTCGAGATTTTGCCGGCTCAATTTGCC
TGCGGCGACGTCAAACGCATCGGCGTCGTCACGGCAAAGACCGGAAAGACGTACTGGCTGAACCTCGATAACTTG
GGCGGCTACAGAAACGGAAAGGATGGCTTGGACGACATCATCCAGTCCTACCAGAACGAAAACTCCGTCTACAGC
GGTGCCGGGGTCTACCCGCTCGAGGGTGGTTACCTTTACATCAACGTCATTCAGTATCCGACTTCCGTCTTCAAG
TTCTCCTGCAACGGCGGCGTCCCCGCCTTCACAAAGGTCGCCGTCTCGCCCGCCTCCAACGCCTACATTCTCGGC
GTGGGCCACGGAACCGTCACCTCCATGGCAGACCAGCCGGGCAGTGCTCTCCTGTGGGTCACCGACGTGCAGGGA
CCGGGCGTTCGCGTCTACAACGCCGTGCCCAAGGACGGAACCCTCGTCAGCGTCAACTCGTTCAACGTCCCTGGT
GTCACCAAGTTTTCCCGTGCCGTCTTTGGCGACGCAATCATGTATGTTGGGACGACGACTGGCTACATCTACGGC
TTCGGGTCACCGGTCAACTCCCCTTTGAACTGCACCTCGCCGCTGGACTTTGGGATCGTCGATATCAAGGCCACC
AGCGACACCAGAGCCATGGTCTGCCGAGCCGTTGTCGACCTCACTATCACCGGTCTTGGGCTGGCCGATGGCAAG
AACTTTGCCCTCTCGGACTCGCCAAAACTGCCCTTGCAGCTAGCTCAGGGGCAGTCGTTTCCCGTGAACGCCAAG
TTCAGCCCTTCGACCGTCGGCCTCCTCTCGGTCAACCTCGTCGTCAACACGACCAACGGCGTCACTGGCTTTAGC
ACCAACACACATGCGCGGCTGGTTGGGACCGGTCGCAGCGCCGGCCCGCTCTTGGCCGTCAGCCCCAACACCGTC
TCGTTTCCCGGCGTCATCGCCGGGCATGATCCGAACGGCGTATCAGAGACGGTCGTGGTTTCCAACAGGGGCAAT
GCTGCTCTGACCATTAGATCGATCCTGCATTCCGCCGACAACTCGACCGCGCTTGAACCTTACGACGGTCAGGGC
GACCTTGTTGTAGGACGATTTACGCTCCAGAAGATACCGACGTTAGTCGCCGCCAACGCTGGAAGCGCCATCAAC
GTGCTCTTTAACTCGTCCGTCAGTGGCACGTTTTCTGCCTTGATCAGGTTCATTACCGACGGCGGCAACGGTAGC
GTCACCATCTACGCATCGTCCGGGCCGGCTCCAGTGGCCCTCCTCGAGTTTCAGACCATCGACGGCCTGGACTGG
GTCAAATATGAGCCAGGTACTCCGTTTAGTTTCGGCAACGTTACCGAGAATACGTCAAGATCTCTCAAATTTCGC
ATCACCAATGCCGCGCCGGCCGGCGGGGTCAAACTGTCATTGACGGTGTCGAAGCCCCCTTTTGGCGTCAGCGGC
CTTATCAAGGCCGTCAACCAGGTCGATCTGGCCGAGGGCACTTCCTTTGCGCCTGGCGAGAGTGCGACGGCGGTC
CTGACCTGTACGGCGCCCAAATCTCAGTGGAACGTCGACCCCTATAACGGCACCTCCCAATGGACGCTGAACACA
AACGACGCTGTGCTCGGCAAGCAATTCGTCCACTTCTCCTGCAGTGCCCTTGCCGAGCAGGCACCTCCCCTACTG
CTGGGTGGGAAGGGACAGTATCGTTACGTTGGCTGCTTCAAAGACAACACGCCCGACCGCCAGCTCCCCATCCAG
GTTGTCGCTGATGACAACCTCACCAATGCCATGTGCATTGCTGCGTGTGCACAGAGCAAGTACGTCTTCTGTGGC
ACAGAGTACCTGCGCGAATGCTGGGCTGGCAACCAGATTCCCATGCAGAAGGTCGACGAAGAAAACTGCAATTAC
AACTGTGCCGGCGCCATCAACCAGATATGTGGTGGGAACGGTGTCAACGAGGGGGCCGGCGGGGCTTACATATCG
CTCTTCGCCGACTCGCTCCGGTGGGACGGCAACCTAACCAGGCCGCCACCACCGGGGCCCGTCGTCAATCCGGGG
GTGGCGGGCTTCGCCAGCATAGGCTGTTACACGGAAGGCAATCCGGACCGGGCGCTGCCAAACGGCGTCAACACA
AACAAGAGGACGGTAGCTGCGTGTGTCAATGCCTGCAAGGCAGCGACCTTCTCCATTGCGGGCGTTGAATACGGA
GGCGAGGTGAGAAAAGCAGGAGTCTTTCGTCGGGAGACTGTATACTGAAGGTCGCAGTGCTGGTGTGGCAATGCG
ATGGGGCGCGGCTCGGTGCCTGCTCCTGCTGCGGACTGTGTGATGACGTGCAATGGTGAGAGCTTCGCTTGCTGA
TTCTTAGAACGGACACTGATGCGCAGGGGATAGATAATTCGACCGAGTATTGCGGCGGGCCGTCGAGGCTTAATA
TTTACCGGCTGGGAGCTCCGTCCAGCTCTTCCTCGTCGAGCTCTTTTTCCTCGTCAGCCGGCGTTGGCACACCCT
CCAACGCCGCCTCCTCGTCCAGGTCGTCTTCGTTCATCCCAGCATCCACAACGGCGAGCAGCAGCTTCCCGACAC
CAACTCCGACCGGACCAGCTATCAAGAAGGCGGTCGGAAGGTACAGCTTCCAGGGATGCTGGACGGAGGCGACCA
ACGGCCGAGCCCTCAGCGGGAATTCGTACGCGGACGACAGGATGACGCTCGAATTTTGCGCAGCTTTCTGCAACG
GGTTCAGATACTTTGCCACCGAATACGGGCGGGAATGCTTCTGTGGCAACAGCCTCGGCGACGGTAGCAATAGGG
CCGAGAACCAGAATGACTGTTCGTTTTCGTGTCCCGGCGATGCTTCTGAATTTTGCGGCGCAGGCGTCAGGCTTC
AGCTTTACATGGTCGCTGGTCCATAGTGCCCCCTTTTTCACCTTTACCCCTTCAATTTTGTCTCAGTGGAGTGAT
CAGGAGCGGGAAGCGGTGCTGAATGTTACATGATGGACGACTGTGATGGAATATACAGCTGGTGATTGACGTCCA
AGGACTTGACGCCAGAGGGGCGTTGCGGAGTAGGTATGTTTTTTCTTCCACCACCATTGACGCAACTGATTACCC
TACTCTGCTGAGGTGGACTATCCAACCAGTTACGTATGAAGAAAAGCAAGAATCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail