Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2864
Gene name
Locationscaffold_23:15297..19555
Strand-
Gene length (bp)4258
Transcript length (bp)3861
Coding sequence length (bp)3858
Protein length (aa) 1286

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 1.8E-16 914 992
PF01822 WSC WSC domain 4.5E-17 1037 1115
PF01822 WSC WSC domain 1.8E-18 1187 1265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 995 1265 4.0E-26
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1038 1265 5.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1037 1265 4.0E-24
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 912 1269 1.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 805 1122 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 995 1265 4.0E-26
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1038 1265 5.0E-25
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1037 1265 4.0E-24
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 912 1269 1.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 805 1122 6.0E-22
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 912 1123 3.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1185 1267 6.0E-14
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 876 1245 1.0E-13
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 914 1123 2.0E-13
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 910 1123 4.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 913 1123 8.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1037 1131 1.0E-10
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 1013 1166 2.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 1013 1166 2.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 913 1136 3.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 875 1086 5.0E-10
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 1037 1131 2.0E-09
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1177 1261 2.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 1020 1163 4.0E-09
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 914 1086 1.0E-08
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 914 1086 2.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 1036 1153 3.0E-08
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 1037 1142 3.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 1035 1153 4.0E-08
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 1037 1124 3.0E-07
sp|Q90Y90|KREM1_XENLA Kremen protein 1 OS=Xenopus laevis GN=kremen1 PE=2 SV=1 1036 1122 6.0E-07
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 915 992 2.0E-06
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1183 1286 3.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.156 0.1036 0.9715 0.156 0.0795 0.0182 0.1704 0.1303 0.0823 0.0065

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999759

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3480
Ophiocordyceps australis map64 (Brazil) OphauB2|6705
Ophiocordyceps camponoti-floridani Ophcf2|02181
Ophiocordyceps camponoti-rufipedis Ophun1|1479
Ophiocordyceps kimflemingae Ophio5|2863
Ophiocordyceps kimflemingae Ophio5|2864 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10134
Ophiocordyceps subramaniannii Hirsu2|559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2864
MKSLLLLALVGLVDALALTDTITWGGDGSRAGYQPNHNMDPAIVASPQFGQLFGTLLPGSFAGQPEQIYSQPLVY
TPVGGRQFVYVATTLNNIYKLDAKSGAILASRNLHVPFLTADLDGCNDINPAVGIIATGTIDPTTDTLYLTAKTY
VDQTLGGRPQGRPAGRYYVHALDVNDLTERPNFPVDLQGILARNNPSRMFTGGIHLQRPALLLAGRYLYAGFASH
CVQYNFTGWIMGLDKSTGAIVERWSTQGAGVPDNIRGGGIWMSGGGLSYDGAGSIFLATGNGYASQLSTIPVRGY
NPPTSLEEAALHLTMNPDGSLNLVDFFMPWEKQAMDGADKDLGTSPLEILPAQFACGDVKRIGVVTAKTGKTYWL
NLDNLGGYRNGKDGLDDIIQSYQNENSVYSGAGVYPLEGGYLYINVIQYPTSVFKFSCNGGVPAFTKVAVSPASN
AYILGVGHGTVTSMADQPGSALLWVTDVQGPGVRVYNAVPKDGTLVSVNSFNVPGVTKFSRAVFGDAIMYVGTTT
GYIYGFGSPVNSPLNCTSPLDFGIVDIKATSDTRAMVCRAVVDLTITGLGLADGKNFALSDSPKLPLQLAQGQSF
PVNAKFSPSTVGLLSVNLVVNTTNGVTGFSTNTHARLVGTGRSAGPLLAVSPNTVSFPGVIAGHDPNGVSETVVV
SNRGNAALTIRSILHSADNSTALEPYDGQGDLVVGRFTLQKIPTLVAANAGSAINVLFNSSVSGTFSALIRFITD
GGNGSVTIYASSGPAPVALLEFQTIDGLDWVKYEPGTPFSFGNVTENTSRSLKFRITNAAPAGGVKLSLTVSKPP
FGVSGLIKAVNQVDLAEGTSFAPGESATAVLTCTAPKSQWNVDPYNGTSQWTLNTNDAVLGKQFVHFSCSALAEQ
APPLLLGGKGQYRYVGCFKDNTPDRQLPIQVVADDNLTNAMCIAACAQSKYVFCGTEYLRECWAGNQIPMQKVDE
ENCNYNCAGAINQICGGNGVNEGAGGAYISLFADSLRWDGNLTRPPPPGPVVNPGVAGFASIGCYTEGNPDRALP
NGVNTNKRTVAACVNACKAATFSIAGVEYGGECWCGNAMGRGSVPAPAADCVMTCNDNSTEYCGGPSRLNIYRLG
APSSSSSSSSFSSSAGVGTPSNAASSSRSSSFIPASTTASSSFPTPTPTGPAIKKAVGRYSFQGCWTEATNGRAL
SGNSYADDRMTLEFCAAFCNGFRYFATEYGRECFCGNSLGDGSNRAENQNDCSFSCPGDASEFCGAGDLTPEGRC
GVVTYEEKQES
Coding >Ophio5|2864
ATGAAGTCTCTCCTGCTGTTGGCCCTTGTCGGTCTCGTCGATGCCCTCGCTTTGACAGACACCATCACCTGGGGC
GGTGATGGCTCCCGAGCCGGATACCAGCCAAACCACAACATGGATCCGGCCATCGTCGCCAGTCCCCAGTTCGGC
CAGCTGTTTGGCACCTTGCTGCCAGGCTCTTTCGCCGGTCAACCGGAGCAAATCTACTCGCAGCCTCTCGTCTAC
ACCCCTGTCGGGGGTCGCCAGTTCGTCTACGTTGCCACGACGCTCAACAACATCTATAAGCTGGATGCCAAGTCT
GGCGCCATCCTTGCCTCGCGGAACCTTCACGTACCCTTCCTCACGGCAGACTTGGATGGCTGTAACGACATCAAC
CCGGCTGTGGGAATCATTGCAACCGGCACTATCGATCCGACCACCGATACCCTCTATCTCACAGCCAAGACGTAT
GTCGACCAAACGCTTGGCGGCAGACCCCAGGGCAGGCCTGCTGGTCGCTATTATGTTCACGCCCTGGATGTAAAC
GACCTAACGGAGCGTCCCAACTTCCCCGTTGACTTACAAGGCATCCTCGCCAGAAATAACCCTTCTCGCATGTTC
ACCGGCGGCATCCACCTTCAACGGCCTGCCCTGTTGCTCGCCGGCCGATACCTCTACGCCGGCTTCGCCTCTCAC
TGTGTTCAGTACAACTTTACCGGTTGGATCATGGGCTTGGACAAGTCCACCGGCGCCATCGTCGAACGATGGTCT
ACCCAGGGTGCGGGTGTGCCCGACAATATCAGGGGAGGCGGCATCTGGATGTCCGGCGGCGGCCTCTCCTACGAC
GGCGCCGGCTCTATTTTCCTCGCCACCGGCAACGGTTATGCCAGCCAGCTCAGCACGATTCCCGTTAGGGGCTAC
AACCCGCCAACCTCGCTGGAGGAGGCCGCGCTGCATCTCACCATGAACCCAGACGGTAGCTTAAATCTGGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCCATGGACGGCGCCGACAAGGACCTCGGCACCAGCCCTCTCGAGATTTTG
CCGGCTCAATTTGCCTGCGGCGACGTCAAACGCATCGGCGTCGTCACGGCAAAGACCGGAAAGACGTACTGGCTG
AACCTCGATAACTTGGGCGGCTACAGAAACGGAAAGGATGGCTTGGACGACATCATCCAGTCCTACCAGAACGAA
AACTCCGTCTACAGCGGTGCCGGGGTCTACCCGCTCGAGGGTGGTTACCTTTACATCAACGTCATTCAGTATCCG
ACTTCCGTCTTCAAGTTCTCCTGCAACGGCGGCGTCCCCGCCTTCACAAAGGTCGCCGTCTCGCCCGCCTCCAAC
GCCTACATTCTCGGCGTGGGCCACGGAACCGTCACCTCCATGGCAGACCAGCCGGGCAGTGCTCTCCTGTGGGTC
ACCGACGTGCAGGGACCGGGCGTTCGCGTCTACAACGCCGTGCCCAAGGACGGAACCCTCGTCAGCGTCAACTCG
TTCAACGTCCCTGGTGTCACCAAGTTTTCCCGTGCCGTCTTTGGCGACGCAATCATGTATGTTGGGACGACGACT
GGCTACATCTACGGCTTCGGGTCACCGGTCAACTCCCCTTTGAACTGCACCTCGCCGCTGGACTTTGGGATCGTC
GATATCAAGGCCACCAGCGACACCAGAGCCATGGTCTGCCGAGCCGTTGTCGACCTCACTATCACCGGTCTTGGG
CTGGCCGATGGCAAGAACTTTGCCCTCTCGGACTCGCCAAAACTGCCCTTGCAGCTAGCTCAGGGGCAGTCGTTT
CCCGTGAACGCCAAGTTCAGCCCTTCGACCGTCGGCCTCCTCTCGGTCAACCTCGTCGTCAACACGACCAACGGC
GTCACTGGCTTTAGCACCAACACACATGCGCGGCTGGTTGGGACCGGTCGCAGCGCCGGCCCGCTCTTGGCCGTC
AGCCCCAACACCGTCTCGTTTCCCGGCGTCATCGCCGGGCATGATCCGAACGGCGTATCAGAGACGGTCGTGGTT
TCCAACAGGGGCAATGCTGCTCTGACCATTAGATCGATCCTGCATTCCGCCGACAACTCGACCGCGCTTGAACCT
TACGACGGTCAGGGCGACCTTGTTGTAGGACGATTTACGCTCCAGAAGATACCGACGTTAGTCGCCGCCAACGCT
GGAAGCGCCATCAACGTGCTCTTTAACTCGTCCGTCAGTGGCACGTTTTCTGCCTTGATCAGGTTCATTACCGAC
GGCGGCAACGGTAGCGTCACCATCTACGCATCGTCCGGGCCGGCTCCAGTGGCCCTCCTCGAGTTTCAGACCATC
GACGGCCTGGACTGGGTCAAATATGAGCCAGGTACTCCGTTTAGTTTCGGCAACGTTACCGAGAATACGTCAAGA
TCTCTCAAATTTCGCATCACCAATGCCGCGCCGGCCGGCGGGGTCAAACTGTCATTGACGGTGTCGAAGCCCCCT
TTTGGCGTCAGCGGCCTTATCAAGGCCGTCAACCAGGTCGATCTGGCCGAGGGCACTTCCTTTGCGCCTGGCGAG
AGTGCGACGGCGGTCCTGACCTGTACGGCGCCCAAATCTCAGTGGAACGTCGACCCCTATAACGGCACCTCCCAA
TGGACGCTGAACACAAACGACGCTGTGCTCGGCAAGCAATTCGTCCACTTCTCCTGCAGTGCCCTTGCCGAGCAG
GCACCTCCCCTACTGCTGGGTGGGAAGGGACAGTATCGTTACGTTGGCTGCTTCAAAGACAACACGCCCGACCGC
CAGCTCCCCATCCAGGTTGTCGCTGATGACAACCTCACCAATGCCATGTGCATTGCTGCGTGTGCACAGAGCAAG
TACGTCTTCTGTGGCACAGAGTACCTGCGCGAATGCTGGGCTGGCAACCAGATTCCCATGCAGAAGGTCGACGAA
GAAAACTGCAATTACAACTGTGCCGGCGCCATCAACCAGATATGTGGTGGGAACGGTGTCAACGAGGGGGCCGGC
GGGGCTTACATATCGCTCTTCGCCGACTCGCTCCGGTGGGACGGCAACCTAACCAGGCCGCCACCACCGGGGCCC
GTCGTCAATCCGGGGGTGGCGGGCTTCGCCAGCATAGGCTGTTACACGGAAGGCAATCCGGACCGGGCGCTGCCA
AACGGCGTCAACACAAACAAGAGGACGGTAGCTGCGTGTGTCAATGCCTGCAAGGCAGCGACCTTCTCCATTGCG
GGCGTTGAATACGGAGGCGAGTGCTGGTGTGGCAATGCGATGGGGCGCGGCTCGGTGCCTGCTCCTGCTGCGGAC
TGTGTGATGACGTGCAATGATAATTCGACCGAGTATTGCGGCGGGCCGTCGAGGCTTAATATTTACCGGCTGGGA
GCTCCGTCCAGCTCTTCCTCGTCGAGCTCTTTTTCCTCGTCAGCCGGCGTTGGCACACCCTCCAACGCCGCCTCC
TCGTCCAGGTCGTCTTCGTTCATCCCAGCATCCACAACGGCGAGCAGCAGCTTCCCGACACCAACTCCGACCGGA
CCAGCTATCAAGAAGGCGGTCGGAAGGTACAGCTTCCAGGGATGCTGGACGGAGGCGACCAACGGCCGAGCCCTC
AGCGGGAATTCGTACGCGGACGACAGGATGACGCTCGAATTTTGCGCAGCTTTCTGCAACGGGTTCAGATACTTT
GCCACCGAATACGGGCGGGAATGCTTCTGTGGCAACAGCCTCGGCGACGGTAGCAATAGGGCCGAGAACCAGAAT
GACTGTTCGTTTTCGTGTCCCGGCGATGCTTCTGAATTTTGCGGCGCAGGCGACTTGACGCCAGAGGGGCGTTGC
GGAGTAGTTACGTATGAAGAAAAGCAAGAATCC
Transcript >Ophio5|2864
ATGAAGTCTCTCCTGCTGTTGGCCCTTGTCGGTCTCGTCGATGCCCTCGCTTTGACAGACACCATCACCTGGGGC
GGTGATGGCTCCCGAGCCGGATACCAGCCAAACCACAACATGGATCCGGCCATCGTCGCCAGTCCCCAGTTCGGC
CAGCTGTTTGGCACCTTGCTGCCAGGCTCTTTCGCCGGTCAACCGGAGCAAATCTACTCGCAGCCTCTCGTCTAC
ACCCCTGTCGGGGGTCGCCAGTTCGTCTACGTTGCCACGACGCTCAACAACATCTATAAGCTGGATGCCAAGTCT
GGCGCCATCCTTGCCTCGCGGAACCTTCACGTACCCTTCCTCACGGCAGACTTGGATGGCTGTAACGACATCAAC
CCGGCTGTGGGAATCATTGCAACCGGCACTATCGATCCGACCACCGATACCCTCTATCTCACAGCCAAGACGTAT
GTCGACCAAACGCTTGGCGGCAGACCCCAGGGCAGGCCTGCTGGTCGCTATTATGTTCACGCCCTGGATGTAAAC
GACCTAACGGAGCGTCCCAACTTCCCCGTTGACTTACAAGGCATCCTCGCCAGAAATAACCCTTCTCGCATGTTC
ACCGGCGGCATCCACCTTCAACGGCCTGCCCTGTTGCTCGCCGGCCGATACCTCTACGCCGGCTTCGCCTCTCAC
TGTGTTCAGTACAACTTTACCGGTTGGATCATGGGCTTGGACAAGTCCACCGGCGCCATCGTCGAACGATGGTCT
ACCCAGGGTGCGGGTGTGCCCGACAATATCAGGGGAGGCGGCATCTGGATGTCCGGCGGCGGCCTCTCCTACGAC
GGCGCCGGCTCTATTTTCCTCGCCACCGGCAACGGTTATGCCAGCCAGCTCAGCACGATTCCCGTTAGGGGCTAC
AACCCGCCAACCTCGCTGGAGGAGGCCGCGCTGCATCTCACCATGAACCCAGACGGTAGCTTAAATCTGGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCCATGGACGGCGCCGACAAGGACCTCGGCACCAGCCCTCTCGAGATTTTG
CCGGCTCAATTTGCCTGCGGCGACGTCAAACGCATCGGCGTCGTCACGGCAAAGACCGGAAAGACGTACTGGCTG
AACCTCGATAACTTGGGCGGCTACAGAAACGGAAAGGATGGCTTGGACGACATCATCCAGTCCTACCAGAACGAA
AACTCCGTCTACAGCGGTGCCGGGGTCTACCCGCTCGAGGGTGGTTACCTTTACATCAACGTCATTCAGTATCCG
ACTTCCGTCTTCAAGTTCTCCTGCAACGGCGGCGTCCCCGCCTTCACAAAGGTCGCCGTCTCGCCCGCCTCCAAC
GCCTACATTCTCGGCGTGGGCCACGGAACCGTCACCTCCATGGCAGACCAGCCGGGCAGTGCTCTCCTGTGGGTC
ACCGACGTGCAGGGACCGGGCGTTCGCGTCTACAACGCCGTGCCCAAGGACGGAACCCTCGTCAGCGTCAACTCG
TTCAACGTCCCTGGTGTCACCAAGTTTTCCCGTGCCGTCTTTGGCGACGCAATCATGTATGTTGGGACGACGACT
GGCTACATCTACGGCTTCGGGTCACCGGTCAACTCCCCTTTGAACTGCACCTCGCCGCTGGACTTTGGGATCGTC
GATATCAAGGCCACCAGCGACACCAGAGCCATGGTCTGCCGAGCCGTTGTCGACCTCACTATCACCGGTCTTGGG
CTGGCCGATGGCAAGAACTTTGCCCTCTCGGACTCGCCAAAACTGCCCTTGCAGCTAGCTCAGGGGCAGTCGTTT
CCCGTGAACGCCAAGTTCAGCCCTTCGACCGTCGGCCTCCTCTCGGTCAACCTCGTCGTCAACACGACCAACGGC
GTCACTGGCTTTAGCACCAACACACATGCGCGGCTGGTTGGGACCGGTCGCAGCGCCGGCCCGCTCTTGGCCGTC
AGCCCCAACACCGTCTCGTTTCCCGGCGTCATCGCCGGGCATGATCCGAACGGCGTATCAGAGACGGTCGTGGTT
TCCAACAGGGGCAATGCTGCTCTGACCATTAGATCGATCCTGCATTCCGCCGACAACTCGACCGCGCTTGAACCT
TACGACGGTCAGGGCGACCTTGTTGTAGGACGATTTACGCTCCAGAAGATACCGACGTTAGTCGCCGCCAACGCT
GGAAGCGCCATCAACGTGCTCTTTAACTCGTCCGTCAGTGGCACGTTTTCTGCCTTGATCAGGTTCATTACCGAC
GGCGGCAACGGTAGCGTCACCATCTACGCATCGTCCGGGCCGGCTCCAGTGGCCCTCCTCGAGTTTCAGACCATC
GACGGCCTGGACTGGGTCAAATATGAGCCAGGTACTCCGTTTAGTTTCGGCAACGTTACCGAGAATACGTCAAGA
TCTCTCAAATTTCGCATCACCAATGCCGCGCCGGCCGGCGGGGTCAAACTGTCATTGACGGTGTCGAAGCCCCCT
TTTGGCGTCAGCGGCCTTATCAAGGCCGTCAACCAGGTCGATCTGGCCGAGGGCACTTCCTTTGCGCCTGGCGAG
AGTGCGACGGCGGTCCTGACCTGTACGGCGCCCAAATCTCAGTGGAACGTCGACCCCTATAACGGCACCTCCCAA
TGGACGCTGAACACAAACGACGCTGTGCTCGGCAAGCAATTCGTCCACTTCTCCTGCAGTGCCCTTGCCGAGCAG
GCACCTCCCCTACTGCTGGGTGGGAAGGGACAGTATCGTTACGTTGGCTGCTTCAAAGACAACACGCCCGACCGC
CAGCTCCCCATCCAGGTTGTCGCTGATGACAACCTCACCAATGCCATGTGCATTGCTGCGTGTGCACAGAGCAAG
TACGTCTTCTGTGGCACAGAGTACCTGCGCGAATGCTGGGCTGGCAACCAGATTCCCATGCAGAAGGTCGACGAA
GAAAACTGCAATTACAACTGTGCCGGCGCCATCAACCAGATATGTGGTGGGAACGGTGTCAACGAGGGGGCCGGC
GGGGCTTACATATCGCTCTTCGCCGACTCGCTCCGGTGGGACGGCAACCTAACCAGGCCGCCACCACCGGGGCCC
GTCGTCAATCCGGGGGTGGCGGGCTTCGCCAGCATAGGCTGTTACACGGAAGGCAATCCGGACCGGGCGCTGCCA
AACGGCGTCAACACAAACAAGAGGACGGTAGCTGCGTGTGTCAATGCCTGCAAGGCAGCGACCTTCTCCATTGCG
GGCGTTGAATACGGAGGCGAGTGCTGGTGTGGCAATGCGATGGGGCGCGGCTCGGTGCCTGCTCCTGCTGCGGAC
TGTGTGATGACGTGCAATGATAATTCGACCGAGTATTGCGGCGGGCCGTCGAGGCTTAATATTTACCGGCTGGGA
GCTCCGTCCAGCTCTTCCTCGTCGAGCTCTTTTTCCTCGTCAGCCGGCGTTGGCACACCCTCCAACGCCGCCTCC
TCGTCCAGGTCGTCTTCGTTCATCCCAGCATCCACAACGGCGAGCAGCAGCTTCCCGACACCAACTCCGACCGGA
CCAGCTATCAAGAAGGCGGTCGGAAGGTACAGCTTCCAGGGATGCTGGACGGAGGCGACCAACGGCCGAGCCCTC
AGCGGGAATTCGTACGCGGACGACAGGATGACGCTCGAATTTTGCGCAGCTTTCTGCAACGGGTTCAGATACTTT
GCCACCGAATACGGGCGGGAATGCTTCTGTGGCAACAGCCTCGGCGACGGTAGCAATAGGGCCGAGAACCAGAAT
GACTGTTCGTTTTCGTGTCCCGGCGATGCTTCTGAATTTTGCGGCGCAGGCGACTTGACGCCAGAGGGGCGTTGC
GGAGTAGTTACGTATGAAGAAAAGCAAGAATCCTAA
Gene >Ophio5|2864
ATGAAGTCTCTCCTGCTGTTGGCCCTTGTCGGTCTCGTCGATGCCCTCGCTTTGACAGACACCATCACCTGGGGC
GGTGATGGCTCCCGAGCCGGATACCAGCCGTACGAAGTATCTTCTGCCTTGCACTCCTTCCCTCATCTTGCTGAT
ATATCGCCGTCAAGAAACCACAACATGGATCCGGCCATCGTCGCCAGTCCCCAGTTCGGCCAGCTGTTTGGCACC
TTGCTGCCAGGCTCTTTCGCCGGTCAACCGGAGCAAATCTACTCGCAGCCTCTCGTCTACACCCCTGTCGGGGGT
CGCCAGTTCGTCTACGTTGCCACGACGCTCAACAACATCTATAAGCTGGATGCCAAGTCTGGCGCCATCCTTGCC
TCGCGGAACCTTCACGTACCCTTCCTCACGGCAGACTTGGATGGCTGTAACGACATCAACCCGGCTGTGGGAATC
ATTGCAACCGGCACTATCGATCCGACCACCGATACCCTCTATCTCACAGCCAAGACGTATGTCGACCAAACGCTT
GGCGGCAGACCCCAGGGCAGGCCTGCTGGTCGCTATTATGTTCACGCCCTGGATGTAAACGACCTAACGGAGCGT
CCCAACTTCCCCGTTGACTTACAAGGCATCCTCGCCAGAAATAACCCTTCTCGCATGTTCACCGGCGGCATCCAC
CTTCAACGGCCTGCCCTGTTGCTCGCCGGCCGATACCTCTACGCCGGCTTCGCCTCTCACTGTGTTCAGTACAAC
TTTACCGGTTGGATCATGGGCTTGGACAAGTCCACCGGCGCCATCGTCGAACGATGGTCTACCCAGGGTGCGGGT
GTGCCCGACAATATCAGGGGAGGCGGCATCTGGATGTCCGGCGGCGGCCTCTCCTACGACGGCGCCGGCTCTATT
TTCCTCGCCACCGGCAACGGTTATGCCAGCCAGCTCAGCACGATTCCCGTTAGGGGCTACAACCCGCCAACCTCG
CTGGAGGAGGCCGCGCTGCATCTCACCATGAACCCAGACGGTAGCTTAAATCTGGTCGACTTCTTCATGCCCTGG
GAGAAGCAGGCCATGGACGGCGCCGACAAGGACCTCGGCACCAGCCCTCTCGAGATTTTGCCGGCTCAATTTGCC
TGCGGCGACGTCAAACGCATCGGCGTCGTCACGGCAAAGACCGGAAAGACGTACTGGCTGAACCTCGATAACTTG
GGCGGCTACAGAAACGGAAAGGATGGCTTGGACGACATCATCCAGTCCTACCAGAACGAAAACTCCGTCTACAGC
GGTGCCGGGGTCTACCCGCTCGAGGGTGGTTACCTTTACATCAACGTCATTCAGTATCCGACTTCCGTCTTCAAG
TTCTCCTGCAACGGCGGCGTCCCCGCCTTCACAAAGGTCGCCGTCTCGCCCGCCTCCAACGCCTACATTCTCGGC
GTGGGCCACGGAACCGTCACCTCCATGGCAGACCAGCCGGGCAGTGCTCTCCTGTGGGTCACCGACGTGCAGGGA
CCGGGCGTTCGCGTCTACAACGCCGTGCCCAAGGACGGAACCCTCGTCAGCGTCAACTCGTTCAACGTCCCTGGT
GTCACCAAGTTTTCCCGTGCCGTCTTTGGCGACGCAATCATGTATGTTGGGACGACGACTGGCTACATCTACGGC
TTCGGGTCACCGGTCAACTCCCCTTTGAACTGCACCTCGCCGCTGGACTTTGGGATCGTCGATATCAAGGCCACC
AGCGACACCAGAGCCATGGTCTGCCGAGCCGTTGTCGACCTCACTATCACCGGTCTTGGGCTGGCCGATGGCAAG
AACTTTGCCCTCTCGGACTCGCCAAAACTGCCCTTGCAGCTAGCTCAGGGGCAGTCGTTTCCCGTGAACGCCAAG
TTCAGCCCTTCGACCGTCGGCCTCCTCTCGGTCAACCTCGTCGTCAACACGACCAACGGCGTCACTGGCTTTAGC
ACCAACACACATGCGCGGCTGGTTGGGACCGGTCGCAGCGCCGGCCCGCTCTTGGCCGTCAGCCCCAACACCGTC
TCGTTTCCCGGCGTCATCGCCGGGCATGATCCGAACGGCGTATCAGAGACGGTCGTGGTTTCCAACAGGGGCAAT
GCTGCTCTGACCATTAGATCGATCCTGCATTCCGCCGACAACTCGACCGCGCTTGAACCTTACGACGGTCAGGGC
GACCTTGTTGTAGGACGATTTACGCTCCAGAAGATACCGACGTTAGTCGCCGCCAACGCTGGAAGCGCCATCAAC
GTGCTCTTTAACTCGTCCGTCAGTGGCACGTTTTCTGCCTTGATCAGGTTCATTACCGACGGCGGCAACGGTAGC
GTCACCATCTACGCATCGTCCGGGCCGGCTCCAGTGGCCCTCCTCGAGTTTCAGACCATCGACGGCCTGGACTGG
GTCAAATATGAGCCAGGTACTCCGTTTAGTTTCGGCAACGTTACCGAGAATACGTCAAGATCTCTCAAATTTCGC
ATCACCAATGCCGCGCCGGCCGGCGGGGTCAAACTGTCATTGACGGTGTCGAAGCCCCCTTTTGGCGTCAGCGGC
CTTATCAAGGCCGTCAACCAGGTCGATCTGGCCGAGGGCACTTCCTTTGCGCCTGGCGAGAGTGCGACGGCGGTC
CTGACCTGTACGGCGCCCAAATCTCAGTGGAACGTCGACCCCTATAACGGCACCTCCCAATGGACGCTGAACACA
AACGACGCTGTGCTCGGCAAGCAATTCGTCCACTTCTCCTGCAGTGCCCTTGCCGAGCAGGCACCTCCCCTACTG
CTGGGTGGGAAGGGACAGTATCGTTACGTTGGCTGCTTCAAAGACAACACGCCCGACCGCCAGCTCCCCATCCAG
GTTGTCGCTGATGACAACCTCACCAATGCCATGTGCATTGCTGCGTGTGCACAGAGCAAGTACGTCTTCTGTGGC
ACAGAGTACCTGCGCGAATGCTGGGCTGGCAACCAGATTCCCATGCAGAAGGTCGACGAAGAAAACTGCAATTAC
AACTGTGCCGGCGCCATCAACCAGATATGTGGTGGGAACGGTGTCAACGAGGGGGCCGGCGGGGCTTACATATCG
CTCTTCGCCGACTCGCTCCGGTGGGACGGCAACCTAACCAGGCCGCCACCACCGGGGCCCGTCGTCAATCCGGGG
GTGGCGGGCTTCGCCAGCATAGGCTGTTACACGGAAGGCAATCCGGACCGGGCGCTGCCAAACGGCGTCAACACA
AACAAGAGGACGGTAGCTGCGTGTGTCAATGCCTGCAAGGCAGCGACCTTCTCCATTGCGGGCGTTGAATACGGA
GGCGAGGTGAGAAAAGCAGGAGTCTTTCGTCGGGAGACTGTATACTGAAGGTCGCAGTGCTGGTGTGGCAATGCG
ATGGGGCGCGGCTCGGTGCCTGCTCCTGCTGCGGACTGTGTGATGACGTGCAATGGTGAGAGCTTCGCTTGCTGA
TTCTTAGAACGGACACTGATGCGCAGGGGATAGATAATTCGACCGAGTATTGCGGCGGGCCGTCGAGGCTTAATA
TTTACCGGCTGGGAGCTCCGTCCAGCTCTTCCTCGTCGAGCTCTTTTTCCTCGTCAGCCGGCGTTGGCACACCCT
CCAACGCCGCCTCCTCGTCCAGGTCGTCTTCGTTCATCCCAGCATCCACAACGGCGAGCAGCAGCTTCCCGACAC
CAACTCCGACCGGACCAGCTATCAAGAAGGCGGTCGGAAGGTACAGCTTCCAGGGATGCTGGACGGAGGCGACCA
ACGGCCGAGCCCTCAGCGGGAATTCGTACGCGGACGACAGGATGACGCTCGAATTTTGCGCAGCTTTCTGCAACG
GGTTCAGATACTTTGCCACCGAATACGGGCGGGAATGCTTCTGTGGCAACAGCCTCGGCGACGGTAGCAATAGGG
CCGAGAACCAGAATGACTGTTCGTTTTCGTGTCCCGGCGATGCTTCTGAATTTTGCGGCGCAGGCGTCAGGCTTC
AGCTTTACATGGTCGCTGGTCCATAGTGCCCCCTTTTTCACCTTTACCCCTTCAATTTTGTCTCAGTGGAGTGAT
CAGGAGCGGGAAGCGGTGCTGAATGTTACATGATGGACGACTGTGATGGAATATACAGCTGGTGATTGACGTCCA
AGGACTTGACGCCAGAGGGGCGTTGCGGAGTAGGTATGTTTTTTCTTCCACCACCATTGACGCAACTGATTACCC
TACTCTGCTGAGGTGGACTATCCAACCAGTTACGTATGAAGAAAAGCAAGAATCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail