Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2863
Gene name
Locationscaffold_23:13469..15101
Strand-
Gene length (bp)1632
Transcript length (bp)1485
Coding sequence length (bp)1482
Protein length (aa) 494

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07350 DUF1479 Protein of unknown function (DUF1479) 4.5E-155 46 468

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P75791|YBIU_ECOLI Uncharacterized protein YbiU OS=Escherichia coli (strain K12) GN=ybiU PE=1 SV=1 73 469 3.0E-55

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1132 0.1905 0.0356 0.029 0.7252 0.055 0.0532 0.0366 0.0757 0.0342

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3480
Ophiocordyceps australis map64 (Brazil) OphauB2|6705
Ophiocordyceps camponoti-floridani Ophcf2|02181
Ophiocordyceps camponoti-rufipedis Ophun1|1479
Ophiocordyceps kimflemingae Ophio5|2863 (this protein)
Ophiocordyceps kimflemingae Ophio5|2864
Ophiocordyceps subramaniannii Hirsu2|10134
Ophiocordyceps subramaniannii Hirsu2|559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2863
MLRPRSSWLPRSTNSRLYSSAASSALKKEGDISDAFVSLSRTERTALPDRFRQLKCDLVRGRERSFVDGWTRLLQ
RLRTENELIAQRGSDIIPQLDLEHLERGCEEELKNEIKRRGAVVVRGVIPEDEARGYKFEVEEYIAKNPQTRAFP
AHDPQVYELYWSSAQVKARAHPKLLGVQSRLMSLFWHSAADGQVSLTNPVTYADRLRIRQPGDASFALGPHMDGG
SVERWEPQGYGRGDVYGEILTGAWERYDGWDAGRRVEAVNNRYNGLGACSMFRAWQGWIAMSSCGPGQGSLLVNP
LVQLATAYVLMRPFFRPLDENRESSSFLHDSNWALMGVEDMTSELQGASPGFGQELNEKLHPHLELDKTMVHIPP
IKPGDFVAWHCDTIHSVDKVHGGESDSSVLYIPVCPATGPNAEYLVRQRAAFRQGSPAPDFPGGEGESRHVGRPR
EESLRVWATPAGRQAFGLERLPVRPEALAGEREAVGRVNAILGL
Coding >Ophio5|2863
ATGTTACGTCCCCGCTCAAGCTGGCTCCCGCGGAGCACCAACAGCCGGCTCTACTCGAGCGCGGCATCATCGGCG
CTTAAGAAGGAGGGCGACATCTCCGACGCGTTCGTTTCCCTGTCGAGAACTGAGCGGACTGCGCTGCCGGACAGG
TTCCGTCAGCTCAAGTGCGACTTGGTGCGGGGACGCGAGCGGAGCTTCGTTGATGGATGGACGAGGCTGCTGCAG
CGGCTGAGGACGGAGAATGAGCTAATTGCCCAGAGGGGGTCGGATATCATCCCTCAGCTTGACCTTGAGCATCTG
GAGCGCGGCTGCGAGGAGGAGTTGAAGAATGAGATTAAGAGGAGAGGGGCTGTCGTCGTCAGAGGGGTGATTCCG
GAGGATGAGGCCAGGGGATACAAGTTCGAAGTGGAGGAATATATCGCGAAGAACCCGCAGACTCGAGCCTTCCCC
GCACACGACCCGCAGGTGTACGAGCTCTACTGGTCCAGCGCCCAGGTCAAGGCTCGAGCCCATCCGAAGCTTCTT
GGCGTCCAAAGCCGACTCATGTCTCTCTTCTGGCACTCAGCGGCCGACGGCCAAGTATCTCTGACGAACCCGGTC
ACGTACGCGGACCGGCTCCGGATCCGACAGCCCGGCGATGCGTCCTTTGCCCTGGGCCCACACATGGACGGCGGG
AGCGTCGAGCGATGGGAGCCCCAAGGCTACGGCCGCGGCGACGTCTATGGTGAGATACTAACGGGAGCGTGGGAG
AGGTACGACGGGTGGGATGCTGGTCGTCGGGTCGAGGCTGTCAATAATCGGTACAACGGCCTCGGAGCTTGTTCC
ATGTTTCGCGCCTGGCAGGGCTGGATCGCCATGAGTTCGTGTGGTCCGGGACAGGGATCCTTACTGGTGAATCCC
CTCGTGCAGCTCGCCACTGCCTATGTCCTCATGCGGCCATTCTTCAGGCCGCTGGACGAGAATAGGGAGTCGTCG
AGCTTCCTGCATGACAGTAATTGGGCTCTCATGGGCGTCGAGGATATGACGAGTGAGCTTCAAGGGGCGTCACCG
GGGTTCGGTCAGGAGCTGAACGAGAAACTTCATCCGCATCTGGAACTGGATAAGACCATGGTTCATATTCCGCCC
ATCAAACCTGGCGATTTCGTCGCGTGGCATTGCGACACCATCCACTCCGTCGACAAAGTTCATGGCGGCGAATCC
GACTCGAGCGTGCTCTACATACCCGTCTGCCCAGCGACGGGCCCCAACGCCGAGTACCTAGTCCGACAGCGGGCC
GCCTTCCGACAGGGCTCGCCGGCGCCCGACTTTCCCGGCGGAGAGGGTGAGTCGCGGCATGTCGGCCGGCCGAGG
GAGGAGTCGCTTCGTGTCTGGGCGACGCCTGCAGGAAGGCAGGCTTTTGGGCTGGAGAGGTTGCCTGTTAGACCT
GAGGCGCTGGCGGGCGAAAGGGAGGCGGTGGGGAGGGTGAATGCTATACTTGGACTT
Transcript >Ophio5|2863
ATGTTACGTCCCCGCTCAAGCTGGCTCCCGCGGAGCACCAACAGCCGGCTCTACTCGAGCGCGGCATCATCGGCG
CTTAAGAAGGAGGGCGACATCTCCGACGCGTTCGTTTCCCTGTCGAGAACTGAGCGGACTGCGCTGCCGGACAGG
TTCCGTCAGCTCAAGTGCGACTTGGTGCGGGGACGCGAGCGGAGCTTCGTTGATGGATGGACGAGGCTGCTGCAG
CGGCTGAGGACGGAGAATGAGCTAATTGCCCAGAGGGGGTCGGATATCATCCCTCAGCTTGACCTTGAGCATCTG
GAGCGCGGCTGCGAGGAGGAGTTGAAGAATGAGATTAAGAGGAGAGGGGCTGTCGTCGTCAGAGGGGTGATTCCG
GAGGATGAGGCCAGGGGATACAAGTTCGAAGTGGAGGAATATATCGCGAAGAACCCGCAGACTCGAGCCTTCCCC
GCACACGACCCGCAGGTGTACGAGCTCTACTGGTCCAGCGCCCAGGTCAAGGCTCGAGCCCATCCGAAGCTTCTT
GGCGTCCAAAGCCGACTCATGTCTCTCTTCTGGCACTCAGCGGCCGACGGCCAAGTATCTCTGACGAACCCGGTC
ACGTACGCGGACCGGCTCCGGATCCGACAGCCCGGCGATGCGTCCTTTGCCCTGGGCCCACACATGGACGGCGGG
AGCGTCGAGCGATGGGAGCCCCAAGGCTACGGCCGCGGCGACGTCTATGGTGAGATACTAACGGGAGCGTGGGAG
AGGTACGACGGGTGGGATGCTGGTCGTCGGGTCGAGGCTGTCAATAATCGGTACAACGGCCTCGGAGCTTGTTCC
ATGTTTCGCGCCTGGCAGGGCTGGATCGCCATGAGTTCGTGTGGTCCGGGACAGGGATCCTTACTGGTGAATCCC
CTCGTGCAGCTCGCCACTGCCTATGTCCTCATGCGGCCATTCTTCAGGCCGCTGGACGAGAATAGGGAGTCGTCG
AGCTTCCTGCATGACAGTAATTGGGCTCTCATGGGCGTCGAGGATATGACGAGTGAGCTTCAAGGGGCGTCACCG
GGGTTCGGTCAGGAGCTGAACGAGAAACTTCATCCGCATCTGGAACTGGATAAGACCATGGTTCATATTCCGCCC
ATCAAACCTGGCGATTTCGTCGCGTGGCATTGCGACACCATCCACTCCGTCGACAAAGTTCATGGCGGCGAATCC
GACTCGAGCGTGCTCTACATACCCGTCTGCCCAGCGACGGGCCCCAACGCCGAGTACCTAGTCCGACAGCGGGCC
GCCTTCCGACAGGGCTCGCCGGCGCCCGACTTTCCCGGCGGAGAGGGTGAGTCGCGGCATGTCGGCCGGCCGAGG
GAGGAGTCGCTTCGTGTCTGGGCGACGCCTGCAGGAAGGCAGGCTTTTGGGCTGGAGAGGTTGCCTGTTAGACCT
GAGGCGCTGGCGGGCGAAAGGGAGGCGGTGGGGAGGGTGAATGCTATACTTGGACTTTAG
Gene >Ophio5|2863
ATGTTACGTCCCCGCTCAAGCTGGCTCCCGCGGAGCACCAACAGCCGGCTCTACTCGAGCGCGGCATCATCGGCG
CTTAAGAAGGAGGGCGACATCTCCGACGCGTTCGTTTCCCTGTCGAGAACTGAGCGGACTGCGCTGCCGGACAGG
TTCCGTCAGCTCAAGTGCGACTTGGTGCGGGGACGCGAGCGGAGCTTCGTTGATGGATGGACGAGGCTGCTGCAG
CGGCTGAGGACGGAGAATGAGCTAATTGCCCAGAGGGGGTCGGATATCATCCCTCAGCTTGACCTTGAGCATCTG
GAGCGCGGCTGCGAGGAGGAGTTGAAGAATGAGATTAAGAGGAGAGGGGCTGTCGTCGTCAGAGGGGTGATTCCG
GAGGATGAGGCCAGGGGATACAAGTTCGAAGTGGAGGAATATATCGCGAAGAACCCGCAGACTCGAGGTGAGAAA
GGGAATTCCCTCTGGGGGCTCTCCTTGACCTCCCTGCTTTTCTTCTTGTCTGACAGAACGACAAGCCTTCCCCGC
ACACGACCCGCAGGTGTACGAGCTCTACTGGTCCAGCGCCCAGGTCAAGGCTCGAGCCCATCCGAAGCTTCTTGG
CGTCCAAAGCCGACTCATGTCTCTCTTCTGGCACTCAGCGGCCGACGGCCAAGTATCTCTGACGAACCCGGTCAC
GTACGCGGACCGGCTCCGGATCCGACAGCCCGGCGATGCGTCCTTTGCCCTGGGCCCACACATGGACGGCGGGAG
CGTCGAGCGATGGGAGCCCCAAGGCTACGGCCGCGGCGACGTCTATGGTGAGATACTAACGGGAGCGTGGGAGAG
GTACGACGGGTGGGATGCTGGTCGTCGGGTCGAGGCTGTCAATAATCGGTACAACGGCCTCGGAGCTTGTTCCAT
GTTTCGCGCCTGGCAGGGCTGGATCGCCATGAGTTCGTGTGGTCCGGGACAGGGATCCTTACTGGTGAATCCCCT
CGTGCAGCTCGCCACTGCCTATGTCCTCATGCGGCCATTCTTCAGGCCGCTGGACGAGAATAGGGAGTCGTCGAG
CTTCCTGCATGACAGTAATTGGGCTCTCATGGGCGTCGAGGATATGACGAGTGAGCTTCAAGGGGCGTCACCGGG
GTTCGGTCAGGAGCTGAACGAGAAACTTCATCCGCATCTGGAACTGGATAAGACCATGGTTCATATTCCGCCCAT
CAAACCTGGCGATTTCGTCGCGTGGCATTGCGACAGTGAGTTTTTCTTATATTTTCTTATTCCCAGCTCTAGGGA
TTCGTCCCTGACCAGCTAACCTTTTTTCACGAAGCCATCCACTCCGTCGACAAAGTTCATGGCGGCGAATCCGAC
TCGAGCGTGCTCTACATACCCGTCTGCCCAGCGACGGGCCCCAACGCCGAGTACCTAGTCCGACAGCGGGCCGCC
TTCCGACAGGGCTCGCCGGCGCCCGACTTTCCCGGCGGAGAGGGTGAGTCGCGGCATGTCGGCCGGCCGAGGGAG
GAGTCGCTTCGTGTCTGGGCGACGCCTGCAGGAAGGCAGGCTTTTGGGCTGGAGAGGTTGCCTGTTAGACCTGAG
GCGCTGGCGGGCGAAAGGGAGGCGGTGGGGAGGGTGAATGCTATACTTGGACTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail