Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2854
Gene name
Locationscaffold_229:20850..22566
Strand+
Gene length (bp)1716
Transcript length (bp)1572
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 1.3E-58 5 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I785|SMP3_GIBZE GPI mannosyltransferase 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SMP3 PE=3 SV=1 1 514 0.0E+00
sp|Q2UTP0|SMP3_ASPOR GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=smp3 PE=3 SV=1 1 515 1.0E-174
sp|Q4WTT7|SMP3_ASPFU GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=smp3 PE=3 SV=2 1 515 1.0E-171
sp|Q5BAX7|SMP3_EMENI GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=smp3 PE=3 SV=2 1 519 2.0E-169
sp|Q6BJ96|SMP3_DEBHA GPI mannosyltransferase 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SMP3 PE=3 SV=2 2 496 9.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I785|SMP3_GIBZE GPI mannosyltransferase 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SMP3 PE=3 SV=1 1 514 0.0E+00
sp|Q2UTP0|SMP3_ASPOR GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=smp3 PE=3 SV=1 1 515 1.0E-174
sp|Q4WTT7|SMP3_ASPFU GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=smp3 PE=3 SV=2 1 515 1.0E-171
sp|Q5BAX7|SMP3_EMENI GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=smp3 PE=3 SV=2 1 519 2.0E-169
sp|Q6BJ96|SMP3_DEBHA GPI mannosyltransferase 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SMP3 PE=3 SV=2 2 496 9.0E-87
sp|Q6CDD0|SMP3_YARLI GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SMP3 PE=3 SV=1 17 487 4.0E-83
sp|Q5A0L9|SMP3_CANAL GPI mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SMP3 PE=3 SV=1 2 496 2.0E-80
sp|Q6CU99|SMP3_KLULA GPI mannosyltransferase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SMP3 PE=3 SV=2 6 512 1.0E-73
sp|Q04174|SMP3_YEAST GPI mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMP3 PE=1 SV=3 7 490 7.0E-73
sp|Q6FMA9|SMP3_CANGA GPI mannosyltransferase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SMP3 PE=3 SV=1 12 489 2.0E-66
sp|Q753C1|SMP3_ASHGO GPI mannosyltransferase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SMP3 PE=3 SV=3 19 490 3.0E-65
sp|Q09837|SMP3_SCHPO GPI mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smp3 PE=3 SV=1 6 516 9.0E-53
sp|Q86VD9|PIGZ_HUMAN GPI mannosyltransferase 4 OS=Homo sapiens GN=PIGZ PE=2 SV=4 9 436 2.0E-34
sp|Q8BTP0|PIGZ_MOUSE GPI mannosyltransferase 4 OS=Mus musculus GN=Pigz PE=2 SV=2 21 438 1.0E-31
sp|Q8MT80|PIGZ_DROME GPI mannosyltransferase 4 OS=Drosophila melanogaster GN=CG45068 PE=2 SV=1 5 453 1.0E-21
sp|P30777|GPI10_YEAST GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI10 PE=1 SV=2 122 431 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 89 111 22
3 168 190 22
4 210 229 19
5 342 364 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2854
MWRRTYLFLVFVRLWFALSPSYLHPDENFQGPEIIAGEIFSYPIRRTWEFTTDHPIRSVFPLWPVYGLPMLLLRW
LWIGNGHDGEIPPIVVFWTLRVLMFFISFVLEDWALHELIPSPRHRRVAVLLVASSYVTWTYQTHTFSNSVETLV
VAWSLVLIQRIIDSRHKSSLLSSAVLGIVAVFGLFNRITFPAFLLIPSLRLIPHLLNNPTSFAALTLVALLTTAV
AIALDTSFYTPESITWRQLITKPVITPLNNFLYNSSTDNLAQHGLHPWYQHLLANIPQLLGPAAILLFTQPHLSI
RLYSAISGLAVLSAFHHQEARFLLPTVPLILSSVRLPTNQAVLRVWVASWVAFNLFMGVLMGTYHQGGIIPGQVF
MSNQPDATQAIWWKTYSPPIWLLDGKNSVLQTRDVMGLEGEALLEQLTSLATCDAPADQLSQEYLKEKNGTYLIA
PASATWLDQHLSNRGTEGLRFREVWRHRRHLNLDDLDFGDGVWETLARVIGQRGLVIFRVTIGCQDIEDTHVA
Coding >Ophio5|2854
ATGTGGCGTCGCACATATCTGTTCCTCGTCTTTGTGCGTCTGTGGTTCGCCTTGTCGCCCAGCTACCTACATCCC
GACGAGAACTTTCAAGGCCCGGAGATTATCGCCGGAGAAATCTTCAGCTACCCGATACGACGGACTTGGGAATTC
ACCACCGACCATCCGATCCGAAGTGTCTTCCCGCTATGGCCCGTCTACGGACTGCCTATGCTACTGCTGCGATGG
CTCTGGATAGGCAACGGACACGACGGCGAAATCCCACCCATCGTCGTCTTCTGGACACTTCGCGTCCTCATGTTC
TTCATCAGCTTCGTGCTTGAGGACTGGGCCCTACACGAGTTGATACCGTCGCCCAGACACCGACGCGTTGCTGTC
CTGCTCGTCGCCTCATCCTACGTCACCTGGACCTATCAGACGCATACATTTTCCAACTCTGTCGAGACTCTAGTT
GTGGCCTGGAGTCTGGTCCTCATTCAGCGCATCATCGATTCCCGTCACAAATCGTCGCTTCTGTCCTCTGCTGTG
CTTGGTATTGTTGCCGTCTTTGGCCTATTTAACCGCATCACTTTTCCGGCTTTTCTCTTGATTCCTAGTCTGCGT
TTGATACCCCATCTGTTGAATAATCCTACGTCTTTTGCAGCCTTGACCCTTGTCGCTCTTCTTACCACCGCAGTG
GCCATCGCACTCGATACCTCCTTTTACACGCCCGAGTCCATCACCTGGCGACAACTCATCACGAAGCCCGTCATC
ACACCTCTCAACAACTTCCTATATAACTCGTCCACCGACAACCTCGCGCAACATGGCCTGCACCCCTGGTATCAA
CACCTTCTGGCAAACATACCGCAGCTGCTGGGGCCGGCGGCCATCCTACTCTTCACCCAGCCTCACCTCTCCATC
CGCCTTTACTCCGCCATATCGGGACTGGCTGTGCTGTCCGCCTTTCATCACCAGGAGGCCCGCTTTCTCCTGCCA
ACGGTGCCTCTGATTCTTTCATCGGTCCGTCTCCCGACCAATCAAGCTGTTCTCCGGGTGTGGGTAGCCTCGTGG
GTAGCCTTCAACCTCTTCATGGGCGTCCTGATGGGCACCTATCACCAGGGAGGCATCATTCCCGGCCAGGTCTTC
ATGAGCAACCAGCCCGACGCCACCCAAGCCATTTGGTGGAAGACGTACTCCCCTCCGATCTGGCTCCTCGACGGC
AAGAACAGCGTCTTGCAGACACGAGACGTCATGGGTCTGGAAGGTGAAGCGTTGCTCGAGCAACTGACGAGCCTC
GCGACCTGCGACGCGCCCGCCGATCAGCTCAGTCAGGAGTACCTCAAGGAGAAGAATGGCACATACCTCATCGCC
CCGGCTTCGGCGACATGGCTGGATCAGCATTTGTCCAACCGGGGGACTGAGGGGTTGCGGTTCCGCGAGGTCTGG
CGCCATCGGAGGCACCTCAACCTTGATGACTTGGATTTCGGTGATGGCGTGTGGGAGACGTTGGCCAGGGTCATT
GGTCAAAGGGGGCTTGTGATATTCAGGGTCACGATTGGCTGTCAGGATATAGAGGACACACATGTTGCA
Transcript >Ophio5|2854
ATGTGGCGTCGCACATATCTGTTCCTCGTCTTTGTGCGTCTGTGGTTCGCCTTGTCGCCCAGCTACCTACATCCC
GACGAGAACTTTCAAGGCCCGGAGATTATCGCCGGAGAAATCTTCAGCTACCCGATACGACGGACTTGGGAATTC
ACCACCGACCATCCGATCCGAAGTGTCTTCCCGCTATGGCCCGTCTACGGACTGCCTATGCTACTGCTGCGATGG
CTCTGGATAGGCAACGGACACGACGGCGAAATCCCACCCATCGTCGTCTTCTGGACACTTCGCGTCCTCATGTTC
TTCATCAGCTTCGTGCTTGAGGACTGGGCCCTACACGAGTTGATACCGTCGCCCAGACACCGACGCGTTGCTGTC
CTGCTCGTCGCCTCATCCTACGTCACCTGGACCTATCAGACGCATACATTTTCCAACTCTGTCGAGACTCTAGTT
GTGGCCTGGAGTCTGGTCCTCATTCAGCGCATCATCGATTCCCGTCACAAATCGTCGCTTCTGTCCTCTGCTGTG
CTTGGTATTGTTGCCGTCTTTGGCCTATTTAACCGCATCACTTTTCCGGCTTTTCTCTTGATTCCTAGTCTGCGT
TTGATACCCCATCTGTTGAATAATCCTACGTCTTTTGCAGCCTTGACCCTTGTCGCTCTTCTTACCACCGCAGTG
GCCATCGCACTCGATACCTCCTTTTACACGCCCGAGTCCATCACCTGGCGACAACTCATCACGAAGCCCGTCATC
ACACCTCTCAACAACTTCCTATATAACTCGTCCACCGACAACCTCGCGCAACATGGCCTGCACCCCTGGTATCAA
CACCTTCTGGCAAACATACCGCAGCTGCTGGGGCCGGCGGCCATCCTACTCTTCACCCAGCCTCACCTCTCCATC
CGCCTTTACTCCGCCATATCGGGACTGGCTGTGCTGTCCGCCTTTCATCACCAGGAGGCCCGCTTTCTCCTGCCA
ACGGTGCCTCTGATTCTTTCATCGGTCCGTCTCCCGACCAATCAAGCTGTTCTCCGGGTGTGGGTAGCCTCGTGG
GTAGCCTTCAACCTCTTCATGGGCGTCCTGATGGGCACCTATCACCAGGGAGGCATCATTCCCGGCCAGGTCTTC
ATGAGCAACCAGCCCGACGCCACCCAAGCCATTTGGTGGAAGACGTACTCCCCTCCGATCTGGCTCCTCGACGGC
AAGAACAGCGTCTTGCAGACACGAGACGTCATGGGTCTGGAAGGTGAAGCGTTGCTCGAGCAACTGACGAGCCTC
GCGACCTGCGACGCGCCCGCCGATCAGCTCAGTCAGGAGTACCTCAAGGAGAAGAATGGCACATACCTCATCGCC
CCGGCTTCGGCGACATGGCTGGATCAGCATTTGTCCAACCGGGGGACTGAGGGGTTGCGGTTCCGCGAGGTCTGG
CGCCATCGGAGGCACCTCAACCTTGATGACTTGGATTTCGGTGATGGCGTGTGGGAGACGTTGGCCAGGGTCATT
GGTCAAAGGGGGCTTGTGATATTCAGGGTCACGATTGGCTGTCAGGATATAGAGGACACACATGTTGCATAG
Gene >Ophio5|2854
ATGTGGCGTCGCACATATCTGTTCCTCGTCTTTGTGCGTCTGTGGTTCGCCTTGTCGCCCAGCTACCTACATCCC
GACGAGAACTTTCAAGGCCCGGAGATTATCGCCGGTATGTGTACCTGCTCCGTCTCTTGCTCTGCTAACCCGCCG
TATAGGAGAAATCTTCAGCTACCCGATACGACGGACTTGGGAATTCACCACCGACCATCCGATCCGAAGTGTCTT
CCCGCTATGGCCCGTCTACGGACTGCCTATGCTACTGCTGCGATGGCTCTGGATAGGCAACGGACACGACGGCGA
AATCCCACCCATCGTCGTCTTCTGGACACTTCGCGTCCTCATGTTCTTCATCAGCTTCGTGCTTGAGGACTGGGC
CCTACACGAGTTGATACCGTCGCCCAGACACCGACGCGTTGCTGTCCTGCTCGTCGCCTCATCCTACGTCACCTG
GACCTATCAGACGCATACATTTTCCAACTCTGTCGAGACTCTAGTTGTGGCCTGGAGTCTGGTCCTCATTCAGCG
CATCATCGATTCCCGTGTAGGTTCAACTCACCAATACAAAGTGTCATCATGCGCTGACAAGTTTGCTAGCACAAA
TCGTCGCTTCTGTCCTCTGCTGTGCTTGGTATTGTTGCCGTCTTTGGCCTATTTAACCGCATCACTTTTCCGGCT
TTTCTCTTGATTCCTAGTCTGCGTTTGATACCCCATCTGTTGAATAAGTGAGTGCTCCAATACCGGCTTCCAGGC
TATTCTGACTGGCGCAGTCCTACGTCTTTTGCAGCCTTGACCCTTGTCGCTCTTCTTACCACCGCAGTGGCCATC
GCACTCGATACCTCCTTTTACACGCCCGAGTCCATCACCTGGCGACAACTCATCACGAAGCCCGTCATCACACCT
CTCAACAACTTCCTATATAACTCGTCCACCGACAACCTCGCGCAACATGGCCTGCACCCCTGGTATCAACACCTT
CTGGCAAACATACCGCAGCTGCTGGGGCCGGCGGCCATCCTACTCTTCACCCAGCCTCACCTCTCCATCCGCCTT
TACTCCGCCATATCGGGACTGGCTGTGCTGTCCGCCTTTCATCACCAGGAGGCCCGCTTTCTCCTGCCAACGGTG
CCTCTGATTCTTTCATCGGTCCGTCTCCCGACCAATCAAGCTGTTCTCCGGGTGTGGGTAGCCTCGTGGGTAGCC
TTCAACCTCTTCATGGGCGTCCTGATGGGCACCTATCACCAGGGAGGCATCATTCCCGGCCAGGTCTTCATGAGC
AACCAGCCCGACGCCACCCAAGCCATTTGGTGGAAGACGTACTCCCCTCCGATCTGGCTCCTCGACGGCAAGAAC
AGCGTCTTGCAGACACGAGACGTCATGGGTCTGGAAGGTGAAGCGTTGCTCGAGCAACTGACGAGCCTCGCGACC
TGCGACGCGCCCGCCGATCAGCTCAGTCAGGAGTACCTCAAGGAGAAGAATGGCACATACCTCATCGCCCCGGCT
TCGGCGACATGGCTGGATCAGCATTTGTCCAACCGGGGGACTGAGGGGTTGCGGTTCCGCGAGGTCTGGCGCCAT
CGGAGGCACCTCAACCTTGATGACTTGGATTTCGGTGATGGCGTGTGGGAGACGTTGGCCAGGGTCATTGGTCAA
AGGGGGCTTGTGATATTCAGGGTCACGATTGGCTGTCAGGATATAGAGGACACACATGTTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail