Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2846
Gene name
Locationscaffold_229:5347..6064
Strand+
Gene length (bp)717
Transcript length (bp)630
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10447 EXOSC1 Exosome component EXOSC1/CSL4 3.3E-14 116 156
PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region 4.4E-11 12 47

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9DAA6|EXOS1_MOUSE Exosome complex component CSL4 OS=Mus musculus GN=Exosc1 PE=1 SV=1 11 207 8.0E-44
sp|Q9Y3B2|EXOS1_HUMAN Exosome complex component CSL4 OS=Homo sapiens GN=EXOSC1 PE=1 SV=1 11 207 6.0E-43
sp|O59821|CSL4_SCHPO Exosome complex component csl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csl4 PE=3 SV=2 40 208 9.0E-42
sp|P53859|CSL4_YEAST Exosome complex component CSL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSL4 PE=1 SV=1 1 208 1.0E-27

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0000178 exosome (RNase complex) Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:1905354 exoribonuclease complex No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2846
MAAHDQVPSSALPGDRLGPLSKYAPGPGTHVYDGHVVSSLLGRVAVTPATRSAGPTKRLNKITGSVDAEPATISV
SRHGRQREVLPDVSSEVLARVVRLMPKQAIVVIQQVGDTVLQTEWQGVIRVQDVRATEKDKVKMHEAFKPGDIVR
ARVISLGDQANYYLSTASNELGVIMATSEAGNDMVPISWKEYQDPETGLTEPRKVAKPN
Coding >Ophio5|2846
ATGGCCGCCCACGATCAAGTCCCCTCGTCCGCCCTCCCCGGTGACCGCCTGGGCCCTCTCTCCAAGTACGCTCCA
GGCCCAGGCACCCACGTCTACGACGGTCATGTCGTGTCGTCGCTACTGGGCCGCGTCGCCGTGACGCCAGCGACA
CGCTCAGCCGGTCCCACGAAGCGCCTCAACAAAATTACCGGCTCTGTCGACGCCGAGCCGGCCACCATCTCCGTG
TCGAGACATGGCCGGCAGCGCGAGGTGCTACCGGATGTGTCGAGCGAGGTGCTGGCGCGCGTGGTGCGCCTTATG
CCCAAGCAGGCCATCGTCGTCATCCAGCAGGTTGGCGATACGGTGCTGCAGACGGAATGGCAGGGCGTCATTCGC
GTGCAGGACGTGCGGGCTACGGAGAAAGACAAGGTTAAGATGCACGAGGCCTTTAAGCCGGGCGACATTGTCCGC
GCACGGGTGATTTCCCTCGGCGATCAGGCCAACTATTACCTGTCGACGGCGTCCAACGAATTGGGAGTCATCATG
GCCACCAGCGAGGCTGGCAACGACATGGTGCCCATCAGCTGGAAGGAATACCAGGACCCCGAGACGGGCCTGACG
GAGCCGAGAAAAGTGGCCAAGCCGAAT
Transcript >Ophio5|2846
ATGGCCGCCCACGATCAAGTCCCCTCGTCCGCCCTCCCCGGTGACCGCCTGGGCCCTCTCTCCAAGTACGCTCCA
GGCCCAGGCACCCACGTCTACGACGGTCATGTCGTGTCGTCGCTACTGGGCCGCGTCGCCGTGACGCCAGCGACA
CGCTCAGCCGGTCCCACGAAGCGCCTCAACAAAATTACCGGCTCTGTCGACGCCGAGCCGGCCACCATCTCCGTG
TCGAGACATGGCCGGCAGCGCGAGGTGCTACCGGATGTGTCGAGCGAGGTGCTGGCGCGCGTGGTGCGCCTTATG
CCCAAGCAGGCCATCGTCGTCATCCAGCAGGTTGGCGATACGGTGCTGCAGACGGAATGGCAGGGCGTCATTCGC
GTGCAGGACGTGCGGGCTACGGAGAAAGACAAGGTTAAGATGCACGAGGCCTTTAAGCCGGGCGACATTGTCCGC
GCACGGGTGATTTCCCTCGGCGATCAGGCCAACTATTACCTGTCGACGGCGTCCAACGAATTGGGAGTCATCATG
GCCACCAGCGAGGCTGGCAACGACATGGTGCCCATCAGCTGGAAGGAATACCAGGACCCCGAGACGGGCCTGACG
GAGCCGAGAAAAGTGGCCAAGCCGAATTAG
Gene >Ophio5|2846
ATGGCCGCCCACGATCAAGTCCCCTCGTCCGCCCTCCCCGGTGACCGCCTGGGCCCTCTCTCCAAGTACGCTCCA
GGCCCAGGCACCCACGTCTACGACGGTCATGTCGTGTCGTCGCTACTGGGCCGCGTCGCCGTGACGCCAGCGACA
CGCTCAGCCGGTCCCACGAAGCGCCTCAACAAAATTACCGGCTCTGTCGACGCCGAGCCGGCCACCATCTCCGTG
TCGAGACATGGCCGGCAGCGCGAGGTGCTACCGGATGTGTCGAGCGAGGTGCTGGCGCGCGTGGTGCGCCTTATG
CCCAAGCAGGCCATCGTCGTCATCCAGCAGGTTGGCGATACGGTGCTGCAGACGGAATGGCAGGGCGTCATTCGC
GTGCAGGACGTGCGGGCTACGGAGAAAGACAAGGTTAAGATGCACGAGGCCTTTAAGCCGGGCGACATTGTCCGC
GCACGGGTGGTTAGTCTTCTTTTTTCCTCCTTTCGCCTCTCTTTGTACTTTTTTTTTTTCGTCCTTTACCCTCCT
AACGTGAGACGCGCCGCGCAGATTTCCCTCGGCGATCAGGCCAACTATTACCTGTCGACGGCGTCCAACGAATTG
GGAGTCATCATGGCCACCAGCGAGGCTGGCAACGACATGGTGCCCATCAGCTGGAAGGAATACCAGGACCCCGAG
ACGGGCCTGACGGAGCCGAGAAAAGTGGCCAAGCCGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail