Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2845
Gene name
Locationscaffold_229:139..4545
Strand-
Gene length (bp)4406
Transcript length (bp)4281
Coding sequence length (bp)4278
Protein length (aa) 1426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 5.3E-15 319 490
PF00664 ABC_membrane ABC transporter transmembrane region 8.6E-39 854 1111
PF00005 ABC_tran ABC transporter 2.6E-16 581 715
PF00005 ABC_tran ABC transporter 1.2E-25 1182 1339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 99 1416 0.0E+00
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 102 1411 0.0E+00
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 114 1412 0.0E+00
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 105 1411 0.0E+00
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 105 1411 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 99 1416 0.0E+00
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 102 1411 0.0E+00
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 114 1412 0.0E+00
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 105 1411 0.0E+00
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 105 1411 0.0E+00
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 104 1411 0.0E+00
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 111 1411 0.0E+00
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 113 1412 0.0E+00
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 111 1411 0.0E+00
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 101 1412 0.0E+00
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 105 1411 0.0E+00
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 111 1411 0.0E+00
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 111 1411 0.0E+00
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 105 1411 0.0E+00
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 109 1410 0.0E+00
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 109 1410 0.0E+00
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 113 1412 0.0E+00
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 109 1410 0.0E+00
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 108 1416 0.0E+00
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 101 1395 0.0E+00
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 108 1395 0.0E+00
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 101 1411 0.0E+00
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 320 1395 0.0E+00
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 108 1416 0.0E+00
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 114 1410 0.0E+00
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 320 1406 0.0E+00
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 320 1395 0.0E+00
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 96 1411 0.0E+00
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 92 1416 0.0E+00
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 113 1417 0.0E+00
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 105 1410 0.0E+00
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 100 1414 0.0E+00
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 114 1411 0.0E+00
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 93 1405 0.0E+00
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 109 1410 0.0E+00
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 85 1395 0.0E+00
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 113 1410 0.0E+00
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 108 1414 0.0E+00
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 85 1395 0.0E+00
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 320 1395 0.0E+00
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 113 1395 0.0E+00
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 100 1411 0.0E+00
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 114 1395 0.0E+00
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 326 1417 0.0E+00
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 118 1395 0.0E+00
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 111 1395 0.0E+00
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 114 1395 0.0E+00
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 114 1395 0.0E+00
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 102 1395 0.0E+00
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 101 1395 0.0E+00
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 108 1395 0.0E+00
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 111 1407 0.0E+00
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 114 1395 0.0E+00
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 96 1395 0.0E+00
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 178 1412 0.0E+00
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 109 1395 0.0E+00
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 117 1410 0.0E+00
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 117 1410 0.0E+00
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 111 1395 0.0E+00
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 320 1405 3.0E-180
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 91 1405 8.0E-180
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 91 1405 3.0E-179
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 91 1405 1.0E-178
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 100 1395 1.0E-178
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 105 1389 3.0E-177
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 316 1395 1.0E-176
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 111 1411 1.0E-174
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 91 1411 8.0E-174
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 118 1395 9.0E-174
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 320 1398 4.0E-172
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 320 1395 6.0E-172
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 111 1411 4.0E-170
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 320 1395 3.0E-168
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 579 1395 6.0E-163
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 117 1410 6.0E-163
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 117 1410 7.0E-161
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 117 1410 7.0E-161
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 93 1413 9.0E-158
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 582 1395 1.0E-135
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 804 1395 1.0E-115
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 104 784 2.0E-104
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 117 1092 1.0E-79
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 114 781 1.0E-66
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 114 773 3.0E-66
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 114 773 5.0E-66
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 114 773 6.0E-66
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 114 773 8.0E-66
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 114 773 8.0E-66
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 114 773 9.0E-66
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 114 773 1.0E-65
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 114 773 1.0E-65
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 114 773 1.0E-65
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 114 773 1.0E-65
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 114 773 1.0E-65
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 114 773 1.0E-65
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 114 773 1.0E-65
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 114 773 1.0E-65
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 114 773 1.0E-65
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 114 781 3.0E-65
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1131 1410 3.0E-65
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 114 773 4.0E-65
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 114 773 8.0E-65
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 114 773 1.0E-64
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 828 1403 2.0E-64
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 836 1409 2.0E-64
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 828 1403 3.0E-64
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 114 773 4.0E-64
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 114 773 5.0E-64
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 781 1403 6.0E-64
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 781 1403 6.0E-64
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 781 1403 6.0E-64
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 781 1403 7.0E-64
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 781 1403 7.0E-64
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 828 1403 8.0E-64
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 828 1409 1.0E-63
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 114 773 1.0E-63
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 828 1403 2.0E-63
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 828 1409 2.0E-63
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 781 1403 2.0E-63
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 114 773 2.0E-63
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 114 773 2.0E-63
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 828 1409 3.0E-63
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 114 781 3.0E-63
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 114 773 4.0E-63
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 828 1403 8.0E-63
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 114 774 8.0E-63
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 114 773 8.0E-63
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 828 1403 1.0E-62
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 828 1409 1.0E-62
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 882 1423 1.0E-62
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 891 1409 1.0E-62
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 114 773 2.0E-62
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 114 773 2.0E-62
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 114 773 3.0E-62
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 114 773 3.0E-62
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 114 773 3.0E-62
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 836 1403 5.0E-62
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 787 1409 1.0E-61
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 828 1403 1.0E-61
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 114 773 2.0E-61
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 114 773 3.0E-61
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 836 1409 4.0E-61
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 114 781 4.0E-61
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 114 773 2.0E-60
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 828 1403 3.0E-60
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 763 1409 3.0E-60
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 114 773 3.0E-60
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 828 1409 7.0E-60
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 826 1403 8.0E-60
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 836 1413 8.0E-60
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 114 781 1.0E-59
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 828 1409 2.0E-59
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 836 1409 3.0E-59
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 836 1403 3.0E-59
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 114 816 9.0E-59
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 836 1403 1.0E-58
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 836 1409 2.0E-58
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 836 1403 2.0E-58
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 828 1395 4.0E-58
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 828 1403 1.0E-55
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1149 1408 3.0E-55
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 581 1395 4.0E-55
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 828 1403 6.0E-55
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 836 1395 7.0E-55
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 828 1403 9.0E-55
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 828 1403 9.0E-55
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 828 1403 1.0E-54
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 371 1399 2.0E-54
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 540 1388 9.0E-54
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 371 1406 3.0E-51
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 581 1399 8.0E-51
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 581 1395 7.0E-50
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 891 1415 8.0E-50
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 529 1397 4.0E-48
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 581 1399 4.0E-48
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 577 1388 6.0E-48
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 581 1405 4.0E-47
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 505 1399 6.0E-47
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 352 1388 1.0E-46
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 889 1407 2.0E-46
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 895 1411 3.0E-43
sp|Q9FVV9|NAP5_ARATH Probable non-intrinsic ABC protein 5 OS=Arabidopsis thaliana GN=NAP5 PE=2 SV=1 652 936 1.0E-42
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 860 1402 3.0E-41
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 853 1406 9.0E-41
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 904 1420 2.0E-40
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 904 1405 3.0E-40
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 899 1405 6.0E-40
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 929 1408 1.0E-39
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 899 1407 5.0E-39
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 895 1402 6.0E-39
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 855 1426 6.0E-39
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 845 1388 1.0E-38
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 845 1388 1.0E-38
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 845 1388 1.0E-38
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 856 1405 1.0E-38
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 895 1402 1.0E-38
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 929 1408 2.0E-38
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 912 1406 3.0E-38
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 912 1406 3.0E-38
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 912 1406 3.0E-38
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 859 1402 4.0E-38
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 889 1405 7.0E-38
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 899 1405 8.0E-38
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 883 1402 8.0E-38
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 887 1402 1.0E-37
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 856 1405 1.0E-37
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 928 1395 1.0E-37
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 928 1388 2.0E-37
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 849 1402 3.0E-37
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 590 770 4.0E-37
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 928 1395 8.0E-37
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 888 1415 1.0E-36
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 928 1388 1.0E-36
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 928 1388 1.0E-36
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 928 1388 1.0E-36
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 928 1388 2.0E-36
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 928 1388 2.0E-36
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 928 1388 2.0E-36
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 928 1388 2.0E-36
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 928 1388 2.0E-36
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 928 1388 2.0E-36
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 928 1388 2.0E-36
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 888 1426 2.0E-36
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 928 1388 4.0E-36
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 895 1402 4.0E-36
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 939 1397 6.0E-36
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 927 1402 8.0E-36
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 894 1388 8.0E-36
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 1160 1402 8.0E-36
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 888 1402 1.0E-35
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 922 1407 1.0E-35
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 928 1396 1.0E-35
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 1162 1402 1.0E-35
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 928 1396 1.0E-35
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 1162 1402 1.0E-35
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 928 1396 1.0E-35
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 831 1388 2.0E-35
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 891 1405 2.0E-35
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 894 1402 2.0E-35
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 894 1402 2.0E-35
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 894 1402 2.0E-35
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 894 1402 2.0E-35
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1080 1411 2.0E-35
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 928 1388 2.0E-35
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 923 1407 3.0E-35
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 1160 1410 3.0E-35
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 933 1405 3.0E-35
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 927 1402 4.0E-35
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 928 1396 4.0E-35
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 581 1408 4.0E-35
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 879 1405 4.0E-35
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1156 1402 5.0E-35
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 898 1404 5.0E-35
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 927 1402 6.0E-35
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 904 1402 7.0E-35
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 927 1402 7.0E-35
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 1160 1402 1.0E-34
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 927 1388 1.0E-34
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 904 1405 1.0E-34
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 891 1415 1.0E-34
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 888 1402 2.0E-34
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 1163 1413 2.0E-34
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 923 1395 2.0E-34
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 891 1402 2.0E-34
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 904 1386 2.0E-34
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 891 1415 3.0E-34
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 878 1426 3.0E-34
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 886 1402 3.0E-34
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 891 1415 3.0E-34
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 891 1415 3.0E-34
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 1079 1402 4.0E-34
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1163 1408 4.0E-34
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 889 1400 4.0E-34
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 1162 1405 7.0E-34
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 894 1402 7.0E-34
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1148 1412 1.0E-33
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 928 1402 1.0E-33
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 928 1402 1.0E-33
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 898 1405 1.0E-33
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 898 1402 1.0E-33
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 898 1402 1.0E-33
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 904 1405 1.0E-33
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 894 1402 2.0E-33
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 888 1419 2.0E-33
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1159 1412 2.0E-33
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 892 1388 3.0E-33
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 1163 1402 3.0E-33
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 904 1405 3.0E-33
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 927 1402 4.0E-33
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 902 1412 4.0E-33
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 853 1402 5.0E-33
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 1162 1402 5.0E-33
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 936 1405 5.0E-33
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 936 1405 5.0E-33
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 936 1405 5.0E-33
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 936 1405 5.0E-33
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 936 1405 5.0E-33
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 936 1405 5.0E-33
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 936 1405 5.0E-33
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 936 1405 5.0E-33
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 901 1402 6.0E-33
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 1160 1407 7.0E-33
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 917 1388 7.0E-33
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1155 1413 8.0E-33
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1159 1412 8.0E-33
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 887 1402 8.0E-33
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 835 1407 8.0E-33
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 1163 1408 9.0E-33
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 898 1402 9.0E-33
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 1185 1402 9.0E-33
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 1163 1412 1.0E-32
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 907 1420 1.0E-32
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 889 1403 1.0E-32
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 888 1415 1.0E-32
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 302 1402 1.0E-32
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1148 1412 2.0E-32
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 887 1426 2.0E-32
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 887 1426 2.0E-32
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 936 1405 2.0E-32
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 913 1400 2.0E-32
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 900 1414 3.0E-32
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 898 1405 3.0E-32
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 898 1405 3.0E-32
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 910 1386 3.0E-32
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 904 1402 3.0E-32
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 1151 1396 3.0E-32
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 913 1413 3.0E-32
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 894 1412 4.0E-32
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 894 1412 4.0E-32
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 1149 1396 4.0E-32
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 928 1402 4.0E-32
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 928 1402 4.0E-32
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1185 1402 4.0E-32
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1185 1402 4.0E-32
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1185 1402 4.0E-32
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1159 1410 5.0E-32
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 858 1412 5.0E-32
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 913 1413 5.0E-32
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 356 1402 5.0E-32
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 1162 1405 6.0E-32
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1129 1388 6.0E-32
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 948 1396 7.0E-32
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 894 1402 8.0E-32
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 914 1411 8.0E-32
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 927 1402 8.0E-32
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 887 1402 9.0E-32
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 916 1420 1.0E-31
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 1162 1405 1.0E-31
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 896 1388 1.0E-31
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1162 1412 2.0E-31
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 887 1407 2.0E-31
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 895 1408 2.0E-31
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 894 1412 2.0E-31
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 894 1412 2.0E-31
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 907 1405 2.0E-31
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 1079 1402 2.0E-31
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 923 1408 2.0E-31
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1155 1412 3.0E-31
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 942 1405 3.0E-31
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 1163 1407 4.0E-31
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 904 1406 4.0E-31
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 898 1408 4.0E-31
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 785 1141 5.0E-31
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 1162 1402 5.0E-31
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1163 1396 5.0E-31
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 898 1412 6.0E-31
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 898 1407 7.0E-31
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 898 1402 7.0E-31
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 1163 1388 7.0E-31
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 888 1420 7.0E-31
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 1162 1402 7.0E-31
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 1105 1388 8.0E-31
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 923 1402 8.0E-31
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 933 1407 8.0E-31
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1162 1388 1.0E-30
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 904 1396 1.0E-30
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 927 1388 1.0E-30
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 904 1402 1.0E-30
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 894 1402 1.0E-30
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 927 1389 1.0E-30
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 914 1388 2.0E-30
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 910 1386 2.0E-30
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 1105 1402 2.0E-30
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 1101 1402 2.0E-30
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 1105 1388 2.0E-30
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 927 1411 2.0E-30
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 921 1402 2.0E-30
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 887 1407 2.0E-30
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 1079 1388 2.0E-30
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 1105 1402 2.0E-30
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 891 1402 3.0E-30
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 830 1402 3.0E-30
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1126 1415 3.0E-30
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 891 1402 3.0E-30
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 891 1402 3.0E-30
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 1103 1426 3.0E-30
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 1163 1388 4.0E-30
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 1101 1402 4.0E-30
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 891 1402 4.0E-30
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 904 1406 5.0E-30
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 913 1411 5.0E-30
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 1162 1388 5.0E-30
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 928 1407 6.0E-30
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 1163 1405 6.0E-30
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 1163 1405 6.0E-30
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 928 1407 6.0E-30
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 928 1407 6.0E-30
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 904 1402 7.0E-30
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 1160 1406 7.0E-30
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 1002 1402 8.0E-30
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 833 1398 1.0E-29
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 1162 1400 1.0E-29
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1162 1412 1.0E-29
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 581 1402 1.0E-29
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 914 1411 1.0E-29
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 934 1410 1.0E-29
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 913 1402 1.0E-29
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1162 1415 1.0E-29
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1170 1402 1.0E-29
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 903 1388 1.0E-29
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1103 1388 1.0E-29
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 911 1388 2.0E-29
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 896 1388 2.0E-29
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 889 1425 2.0E-29
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 1091 1405 2.0E-29
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 904 1402 2.0E-29
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 904 1402 2.0E-29
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 1161 1405 3.0E-29
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 1163 1407 4.0E-29
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 888 1388 4.0E-29
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 1162 1388 4.0E-29
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 916 1402 4.0E-29
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 929 1393 5.0E-29
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 934 1402 5.0E-29
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 879 1421 5.0E-29
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 929 1393 5.0E-29
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 899 1407 6.0E-29
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 889 1406 7.0E-29
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 929 1391 8.0E-29
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 942 1405 9.0E-29
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 916 1402 1.0E-28
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 876 1402 1.0E-28
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 1162 1405 1.0E-28
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1162 1406 1.0E-28
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 673 1382 2.0E-28
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1162 1388 2.0E-28
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 1162 1388 3.0E-28
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 1124 1406 3.0E-28
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 1103 1414 3.0E-28
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1162 1405 4.0E-28
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 575 765 6.0E-28
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 1103 1426 6.0E-28
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 923 1402 1.0E-27
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 831 1426 1.0E-27
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 895 1388 2.0E-27
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 1164 1422 2.0E-27
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 1147 1388 3.0E-27
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 913 1402 3.0E-27
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 891 1419 3.0E-27
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 891 1419 3.0E-27
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 929 1389 4.0E-27
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1162 1412 4.0E-27
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1162 1388 4.0E-27
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 891 1408 4.0E-27
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 923 1408 4.0E-27
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 1074 1390 5.0E-27
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 886 1411 6.0E-27
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 887 1402 7.0E-27
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1134 1399 8.0E-27
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 581 1405 9.0E-27
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1162 1406 9.0E-27
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 1162 1388 1.0E-26
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 1146 1405 1.0E-26
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1162 1406 2.0E-26
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 943 1400 2.0E-26
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 927 1378 2.0E-26
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 1002 1409 2.0E-26
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 891 1388 3.0E-26
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 889 1388 3.0E-26
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 886 1411 3.0E-26
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 898 1405 4.0E-26
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 318 774 5.0E-26
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 1164 1396 5.0E-26
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 929 1407 5.0E-26
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1122 1388 5.0E-26
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 1160 1405 5.0E-26
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1162 1388 6.0E-26
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 894 1418 6.0E-26
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 881 1388 6.0E-26
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1158 1405 6.0E-26
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 1158 1402 1.0E-25
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 872 1402 1.0E-25
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 923 1407 2.0E-25
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 889 1402 2.0E-25
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 803 1405 3.0E-25
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 1162 1388 4.0E-25
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 1181 1386 4.0E-25
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 1181 1386 4.0E-25
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 1181 1386 4.0E-25
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 928 1405 6.0E-25
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 889 1388 6.0E-25
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 1162 1406 8.0E-25
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 929 1405 8.0E-25
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1162 1388 9.0E-25
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 929 1405 9.0E-25
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 1162 1405 1.0E-24
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 919 1423 2.0E-24
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 922 1402 2.0E-24
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 581 792 3.0E-24
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 1036 1402 3.0E-24
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1036 1402 3.0E-24
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 901 1395 3.0E-24
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 919 1423 3.0E-24
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 919 1408 4.0E-24
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 927 1378 5.0E-24
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 348 791 6.0E-24
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 1139 1423 7.0E-24
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 1139 1423 7.0E-24
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 1139 1423 7.0E-24
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 579 774 8.0E-24
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 583 774 1.0E-23
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 1080 1398 1.0E-23
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 352 775 2.0E-23
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 1124 1388 2.0E-23
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 317 779 3.0E-23
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 1161 1407 3.0E-23
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 1165 1402 4.0E-23
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 1165 1402 4.0E-23
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 1165 1402 4.0E-23
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 114 521 7.0E-23
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 352 775 2.0E-22
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1162 1405 2.0E-22
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 920 1405 2.0E-22
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1149 1405 2.0E-22
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1181 1388 3.0E-22
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 361 774 3.0E-22
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 1165 1415 3.0E-22
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 581 774 6.0E-22
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 581 774 6.0E-22
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 581 774 6.0E-22
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 581 774 6.0E-22
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 908 1395 7.0E-22
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 914 1409 8.0E-22
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 403 777 1.0E-21
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 581 775 1.0E-21
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 324 774 1.0E-21
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 324 774 1.0E-21
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 324 774 1.0E-21
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 324 774 1.0E-21
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 324 774 1.0E-21
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 324 774 1.0E-21
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 324 774 1.0E-21
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1142 1408 1.0E-21
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1162 1405 1.0E-21
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 111 524 2.0E-21
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 887 1405 2.0E-21
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 581 775 2.0E-21
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 324 774 2.0E-21
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 581 774 3.0E-21
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 324 774 3.0E-21
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 544 802 3.0E-21
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 594 984 3.0E-21
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 1163 1402 3.0E-21
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 914 1409 3.0E-21
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 1162 1402 4.0E-21
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1176 1409 5.0E-21
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 852 1420 6.0E-21
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 548 784 8.0E-21
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 459 774 8.0E-21
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 1163 1402 8.0E-21
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 317 783 1.0E-20
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 317 783 1.0E-20
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 317 783 1.0E-20
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 317 783 1.0E-20
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 317 783 1.0E-20
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 317 783 1.0E-20
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 317 783 1.0E-20
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 317 783 1.0E-20
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 583 774 1.0E-20
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 557 775 1.0E-20
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 387 774 1.0E-20
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 403 777 1.0E-20
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 1172 1395 1.0E-20
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 384 785 2.0E-20
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 575 800 2.0E-20
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 1162 1402 2.0E-20
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 1074 1421 4.0E-20
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 274 774 5.0E-20
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 575 795 6.0E-20
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 562 774 7.0E-20
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 581 792 7.0E-20
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 318 774 8.0E-20
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 581 785 8.0E-20
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 317 783 8.0E-20
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 1163 1388 9.0E-20
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 907 1408 9.0E-20
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 581 774 1.0E-19
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 324 792 1.0E-19
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 566 774 1.0E-19
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 376 774 1.0E-19
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 581 774 1.0E-19
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 557 1006 1.0E-19
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 581 778 1.0E-19
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 551 798 1.0E-19
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 551 798 1.0E-19
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1161 1388 1.0E-19
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 1181 1395 1.0E-19
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 383 793 2.0E-19
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 347 816 2.0E-19
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 376 790 2.0E-19
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 336 774 2.0E-19
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 583 774 2.0E-19
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 324 783 2.0E-19
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 342 786 2.0E-19
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 405 776 3.0E-19
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 361 816 3.0E-19
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 324 783 3.0E-19
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 324 783 3.0E-19
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 324 783 3.0E-19
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 341 780 3.0E-19
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 319 795 4.0E-19
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 1181 1395 4.0E-19
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 1170 1395 5.0E-19
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 1154 1405 5.0E-19
sp|Q5H503|METN_XANOR Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metN PE=3 SV=2 1165 1388 6.0E-19
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 119 547 7.0E-19
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 936 1412 7.0E-19
sp|Q2P7S3|METN_XANOM Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metN PE=3 SV=1 1165 1388 8.0E-19
sp|Q6MSQ1|ECFA1_MYCMS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ecfA1 PE=3 SV=1 1165 1414 8.0E-19
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 371 775 9.0E-19
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 581 783 9.0E-19
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 388 774 9.0E-19
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 411 785 9.0E-19
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 581 801 1.0E-18
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 318 774 1.0E-18
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 352 787 1.0E-18
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 361 774 1.0E-18
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 361 774 1.0E-18
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 361 774 1.0E-18
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 404 794 1.0E-18
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 324 783 2.0E-18
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 350 814 2.0E-18
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 543 788 2.0E-18
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 542 794 2.0E-18
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 353 774 3.0E-18
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 353 774 3.0E-18
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 353 774 3.0E-18
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 353 774 3.0E-18
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 319 774 3.0E-18
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 347 787 3.0E-18
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 581 773 3.0E-18
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 1165 1385 3.0E-18
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 581 783 4.0E-18
sp|Q2SRI1|ECFA1_MYCCT Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ecfA1 PE=3 SV=1 1165 1414 4.0E-18
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 563 790 4.0E-18
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 350 798 5.0E-18
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 318 774 5.0E-18
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 524 776 6.0E-18
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 342 774 6.0E-18
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 579 775 8.0E-18
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 581 783 8.0E-18
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 1201 1406 9.0E-18
sp|Q8P4S7|METN_XANCP Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metN PE=3 SV=1 1165 1388 9.0E-18
sp|Q4UQD2|METN_XANC8 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metN PE=3 SV=1 1165 1388 9.0E-18
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 342 774 1.0E-17
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 581 790 1.0E-17
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 371 774 1.0E-17
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 319 774 1.0E-17
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 319 774 1.0E-17
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 594 823 1.0E-17
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 411 785 1.0E-17
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1117 1388 1.0E-17
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 581 776 1.0E-17
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1181 1385 1.0E-17
sp|Q3BNZ3|METN_XANC5 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metN PE=3 SV=1 1165 1388 1.0E-17
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 1165 1388 1.0E-17
sp|Q97KD5|METN_CLOAB Methionine import ATP-binding protein MetN OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metN PE=3 SV=1 1181 1397 1.0E-17
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 1182 1405 1.0E-17
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 581 773 1.0E-17
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 371 783 2.0E-17
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 371 774 2.0E-17
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 319 785 2.0E-17
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 581 773 2.0E-17
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 1144 1386 2.0E-17
sp|Q07PZ0|PHNC1_RHOP5 Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=phnC1 PE=3 SV=1 1167 1400 2.0E-17
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 581 774 3.0E-17
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 318 783 3.0E-17
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 500 774 3.0E-17
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 581 789 3.0E-17
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 1165 1398 3.0E-17
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 570 774 4.0E-17
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 581 777 4.0E-17
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 577 775 4.0E-17
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 581 783 4.0E-17
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 1177 1413 4.0E-17
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 545 775 5.0E-17
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 342 774 5.0E-17
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 371 774 5.0E-17
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 376 774 6.0E-17
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 936 1424 6.0E-17
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 1182 1389 6.0E-17
sp|Q9PF03|METN_XYLFA Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain 9a5c) GN=metN PE=3 SV=1 1182 1388 6.0E-17
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 1183 1388 6.0E-17
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 371 774 7.0E-17
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 361 774 7.0E-17
sp|Q8DWR3|ECFA1_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA1 PE=3 SV=1 1182 1399 7.0E-17
sp|Q8E2L2|ECFA1_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA1 PE=3 SV=1 1182 1399 7.0E-17
sp|Q3JYF4|ECFA1_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA1 PE=3 SV=1 1182 1399 7.0E-17
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 577 775 9.0E-17
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 581 775 9.0E-17
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 581 773 9.0E-17
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 576 783 1.0E-16
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 578 776 1.0E-16
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 581 774 1.0E-16
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 472 773 1.0E-16
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 581 774 1.0E-16
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 380 774 1.0E-16
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 581 747 1.0E-16
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 1165 1388 1.0E-16
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 575 773 1.0E-16
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 318 774 2.0E-16
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 371 774 2.0E-16
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 581 774 2.0E-16
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 528 783 2.0E-16
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 500 774 2.0E-16
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 520 775 2.0E-16
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1159 1388 2.0E-16
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 1181 1399 2.0E-16
sp|Q9PPV1|ECFA1_UREPA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ecfA1 PE=3 SV=1 1165 1396 2.0E-16
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 578 776 3.0E-16
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 371 783 3.0E-16
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 581 774 3.0E-16
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 581 783 3.0E-16
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 1157 1372 3.0E-16
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 492 774 4.0E-16
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 379 792 4.0E-16
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 581 774 4.0E-16
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 581 774 4.0E-16
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 578 776 5.0E-16
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 581 774 5.0E-16
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 361 800 5.0E-16
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 528 775 5.0E-16
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 552 774 6.0E-16
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 552 774 6.0E-16
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 581 774 6.0E-16
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 575 778 6.0E-16
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 357 798 7.0E-16
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 581 774 7.0E-16
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 581 774 7.0E-16
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 578 776 9.0E-16
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 578 776 9.0E-16
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 578 776 9.0E-16
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 578 776 9.0E-16
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 578 776 9.0E-16
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 578 776 9.0E-16
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 578 784 9.0E-16
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 524 776 1.0E-15
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 578 776 1.0E-15
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 578 776 1.0E-15
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 578 776 1.0E-15
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 578 784 1.0E-15
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 460 774 1.0E-15
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 584 809 1.0E-15
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 501 775 1.0E-15
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 601 793 1.0E-15
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 578 784 2.0E-15
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 578 784 2.0E-15
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 581 797 2.0E-15
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 384 774 2.0E-15
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 421 801 2.0E-15
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 581 775 2.0E-15
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 595 778 2.0E-15
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 577 780 2.0E-15
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 577 780 2.0E-15
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 577 780 2.0E-15
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 581 793 2.0E-15
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1029 1405 3.0E-15
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 581 789 3.0E-15
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 592 774 3.0E-15
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 581 789 3.0E-15
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 581 785 3.0E-15
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 595 778 3.0E-15
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 411 775 4.0E-15
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 581 774 4.0E-15
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 595 778 4.0E-15
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 595 792 4.0E-15
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 595 792 4.0E-15
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 595 792 4.0E-15
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 584 785 4.0E-15
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 357 776 5.0E-15
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 578 776 5.0E-15
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 578 776 5.0E-15
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 581 764 5.0E-15
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 581 774 5.0E-15
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 577 774 6.0E-15
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 581 784 6.0E-15
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 581 774 7.0E-15
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 581 774 7.0E-15
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 584 776 7.0E-15
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 319 793 8.0E-15
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 575 774 8.0E-15
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 581 774 9.0E-15
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 581 774 9.0E-15
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 578 785 1.0E-14
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 581 774 1.0E-14
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 584 992 1.0E-14
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 578 774 1.0E-14
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 583 785 2.0E-14
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 325 775 2.0E-14
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 319 774 2.0E-14
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 319 774 2.0E-14
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 319 774 2.0E-14
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 362 774 2.0E-14
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 581 776 2.0E-14
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 595 776 2.0E-14
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 581 774 3.0E-14
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 583 785 3.0E-14
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 380 774 3.0E-14
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 380 774 3.0E-14
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 403 773 3.0E-14
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 581 785 4.0E-14
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 324 791 4.0E-14
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 581 810 4.0E-14
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 577 786 4.0E-14
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 584 840 4.0E-14
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 575 774 5.0E-14
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 577 774 5.0E-14
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 581 786 5.0E-14
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 581 774 5.0E-14
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 324 791 6.0E-14
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 575 774 6.0E-14
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 575 799 6.0E-14
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 581 776 7.0E-14
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 581 785 8.0E-14
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 564 774 8.0E-14
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 467 773 8.0E-14
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 577 774 9.0E-14
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 320 783 1.0E-13
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 581 774 1.0E-13
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 581 790 1.0E-13
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 581 811 1.0E-13
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 577 774 1.0E-13
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 371 774 2.0E-13
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 581 789 2.0E-13
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 550 774 2.0E-13
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 550 774 2.0E-13
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 467 791 2.0E-13
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 581 778 3.0E-13
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 553 773 4.0E-13
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 553 773 4.0E-13
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 592 780 4.0E-13
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 583 783 4.0E-13
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 581 783 5.0E-13
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 577 792 5.0E-13
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 553 773 6.0E-13
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 581 774 6.0E-13
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 581 793 6.0E-13
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 581 775 7.0E-13
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 578 783 7.0E-13
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 579 775 8.0E-13
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 581 774 8.0E-13
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 553 773 9.0E-13
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 583 785 9.0E-13
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 581 789 1.0E-12
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 575 775 1.0E-12
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 581 775 1.0E-12
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 551 801 1.0E-12
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 579 774 2.0E-12
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 581 797 2.0E-12
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 584 779 2.0E-12
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 584 779 2.0E-12
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 581 774 2.0E-12
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 581 774 2.0E-12
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 581 774 2.0E-12
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 402 815 3.0E-12
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 581 790 3.0E-12
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 577 774 4.0E-12
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 577 774 4.0E-12
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 577 774 4.0E-12
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 406 807 4.0E-12
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 584 800 4.0E-12
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 551 801 4.0E-12
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 575 785 4.0E-12
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 584 775 5.0E-12
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 371 774 5.0E-12
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 581 774 5.0E-12
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 581 774 5.0E-12
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 581 800 6.0E-12
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 584 779 6.0E-12
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 584 779 6.0E-12
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 584 773 6.0E-12
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 581 783 6.0E-12
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 591 775 8.0E-12
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 581 774 9.0E-12
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 581 794 1.0E-11
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 583 775 1.0E-11
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 583 785 1.0E-11
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 584 774 1.0E-11
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 581 783 1.0E-11
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 584 797 1.0E-11
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 539 774 1.0E-11
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 539 774 1.0E-11
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 577 792 1.0E-11
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 581 774 1.0E-11
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 557 774 1.0E-11
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 557 774 1.0E-11
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 557 774 1.0E-11
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 581 775 1.0E-11
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 539 785 1.0E-11
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 581 790 2.0E-11
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 492 775 2.0E-11
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 479 774 2.0E-11
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 581 774 2.0E-11
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 583 800 2.0E-11
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 581 792 2.0E-11
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 581 774 3.0E-11
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 581 788 3.0E-11
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 581 783 4.0E-11
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 530 774 5.0E-11
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 592 767 5.0E-11
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 576 788 6.0E-11
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 581 790 9.0E-11
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 581 787 1.0E-10
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 581 815 1.0E-10
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 581 815 1.0E-10
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 581 788 1.0E-10
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 584 775 1.0E-10
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 581 776 1.0E-10
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 575 783 1.0E-10
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 581 797 2.0E-10
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 581 788 2.0E-10
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 1182 1410 3.0E-10
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 581 774 3.0E-10
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 594 784 3.0E-10
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 581 773 3.0E-10
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 581 781 4.0E-10
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 545 774 4.0E-10
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 581 775 4.0E-10
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 1066 1389 4.0E-10
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 581 775 5.0E-10
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 581 764 5.0E-10
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 581 781 6.0E-10
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 563 781 6.0E-10
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 581 792 6.0E-10
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1177 1407 7.0E-10
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 581 775 7.0E-10
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 1182 1410 8.0E-10
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 576 764 8.0E-10
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 1181 1396 8.0E-10
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 581 781 1.0E-09
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 639 774 1.0E-09
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 581 793 1.0E-09
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 584 773 1.0E-09
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 563 781 2.0E-09
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 552 790 2.0E-09
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 581 764 2.0E-09
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 563 781 3.0E-09
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 563 781 3.0E-09
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 563 781 3.0E-09
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 563 781 3.0E-09
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 563 781 3.0E-09
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 581 776 3.0E-09
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 581 774 3.0E-09
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 581 774 3.0E-09
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 581 774 3.0E-09
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 581 774 3.0E-09
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 584 757 3.0E-09
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 581 776 3.0E-09
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 563 781 4.0E-09
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 581 781 4.0E-09
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 581 787 4.0E-09
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 567 786 4.0E-09
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 559 757 4.0E-09
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 581 781 5.0E-09
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 567 786 5.0E-09
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 567 763 6.0E-09
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 581 781 7.0E-09
sp|Q9PPV1|ECFA1_UREPA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ecfA1 PE=3 SV=1 581 769 8.0E-09
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 563 781 9.0E-09
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 581 781 9.0E-09
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 563 781 9.0E-09
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 563 781 9.0E-09
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 563 781 1.0E-08
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 581 834 1.0E-08
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 581 781 1.0E-08
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 581 834 2.0E-08
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 581 781 2.0E-08
sp|Q2SRI1|ECFA1_MYCCT Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ecfA1 PE=3 SV=1 578 783 2.0E-08
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 581 779 3.0E-08
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 581 781 3.0E-08
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 1181 1385 3.0E-08
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 581 781 3.0E-08
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 563 781 3.0E-08
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 320 794 4.0E-08
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 1181 1393 4.0E-08
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 583 774 4.0E-08
sp|Q6MSQ1|ECFA1_MYCMS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ecfA1 PE=3 SV=1 578 783 4.0E-08
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 581 774 4.0E-08
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 567 790 5.0E-08
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 581 781 6.0E-08
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 581 781 7.0E-08
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 567 788 7.0E-08
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 567 788 7.0E-08
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 1181 1384 9.0E-08
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 581 781 1.0E-07
sp|Q8DWR3|ECFA1_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA1 PE=3 SV=1 579 774 1.0E-07
sp|Q8E2L2|ECFA1_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA1 PE=3 SV=1 579 774 1.0E-07
sp|Q3JYF4|ECFA1_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA1 PE=3 SV=1 579 774 1.0E-07
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 581 781 2.0E-07
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 581 781 2.0E-07
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 1181 1384 2.0E-07
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 582 776 2.0E-07
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 581 781 3.0E-07
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 592 764 3.0E-07
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 1181 1384 4.0E-07
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 1181 1384 6.0E-07
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 581 781 7.0E-07
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 402 774 8.0E-07
sp|Q07PZ0|PHNC1_RHOP5 Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=phnC1 PE=3 SV=1 581 727 9.0E-07
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 581 781 1.0E-06
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 1179 1384 1.0E-06
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 581 781 1.0E-06
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 1182 1396 1.0E-06
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 577 774 1.0E-06
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 581 781 2.0E-06
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 1181 1386 2.0E-06
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 1181 1384 2.0E-06
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 1181 1384 2.0E-06
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 581 784 2.0E-06
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 336 779 3.0E-06
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 1181 1386 3.0E-06
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 1181 1386 3.0E-06
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 1181 1384 3.0E-06
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 1181 1386 4.0E-06
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 581 791 4.0E-06
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 1181 1384 5.0E-06
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 1181 1384 6.0E-06
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 1181 1384 6.0E-06
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 1181 1384 6.0E-06
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1177 1393 7.0E-06
sp|Q9FVV9|NAP5_ARATH Probable non-intrinsic ABC protein 5 OS=Arabidopsis thaliana GN=NAP5 PE=2 SV=1 1302 1426 7.0E-06
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 581 782 7.0E-06
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 574 759 7.0E-06
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 1181 1384 8.0E-06
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 1181 1384 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0140359 ABC-type transporter activity Yes
GO:0006810 transport No
GO:0032555 purine ribonucleotide binding No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0043167 ion binding No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 181 203 22
2 234 256 22
3 339 361 22
4 365 387 22
5 854 876 22
6 891 913 22
7 966 985 19
8 989 1006 17
9 1071 1093 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 26.04 14.15 37.93
CcL In ants, during behavior modification 32.54 17.22 47.87
CcD In ants, recently dead 25.20 13.71 36.69

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.364169 no
SC16a CcD 0.910426 no
CcL CcD 0.285945 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2845
MARSLGKNESDAPDAANIRQSLDSEVQIEKALDSGEDEKIEIDQGGKIDKQTGEPNIDPLTATKSQATDVSLTTF
APVQRLQKPRTWRDRINPLRWGPVPAAPDEPIVSREYTAGFFSQLTFEWMTPLMMAGYKRPLERRDIWTVNPDRA
VEPLADRVRDSMRRRIQSGQKYPLLWALHETLFLEFWLGGLFAFVGFLPQVLAPFTLRYLIQFAADAYHAHVSNR
PPPPIGHGIGLVLGITAMQLLQSVCINHFIYRGMMMGGESRGLLISLIYEKAMVISGRARAGDVRDGRQEKRQQD
GQKPKKKQKGAKDGIGWANGRIVNLMSVDTYRIDQASSLGHMIWAGPILCLITLVLLLINLTYSALAGYGLLVIG
IPALTRAIRSLFRRRSQINKITDQRVSLTQEILQSVRFVKFFGWEKAFTDRLGQIRSREIYSIQVLLAIRNGINA
ISMSLPVFASMLSFITYSLTSHSLSPAQVFSSLALFNSLRIPLNLLPTVLGQVVDAWSSLKRIEEFLGQEEQDED
LDVAPECVNAIELRAASFTWERTPTQDTADKQESPRSTSKDDTASTLVEERDPYKLQDLNLEAGRKELIAVIGSV
GSGKSSLLAALAGDMRKTSGEVVFGASRAFCPQYAWVQNSTLRDNITFGQDMDKRWYKKVIKACALQADLDMLPN
GDLTEIGERGITISGGQKQRLNIARAIYFDADVVLMDDPLSAVDAHVGRHIFDSAILGLLKDKCRILATHQLWVL
SRCDRIVWMERGKIQAVGTFDSLLRDYQSFRTLMETTAEEGEKDASAPETALTTAAAAVPEKEEKKAKKGAALMQ
QEERAEAGVPWSVYGAYVSASGSLFNAPLIILLLLLSQGANIMTSLWLSYWTSDRFSMSEGQYIGIYAGLGGVQA
LLMFAMSVALSVLGTRASKVMLRDAVNRVLRAPMSFFDTTPLGRITNRFSRDVDVLDNTLTDSMRMFFFTLAMTT
AVFALVIAFFPYFAIALGPLYVLYVVAASYYRASAREVKRFESVLRSHVFAKFSEGLSGVATIRAYGLRARFVGE
LRAAIDDMNSAYYLTFSNQRWLSVRLDMIGNILVFVVGLLVVTSRFSVDPSIGGLVLSYIVSIVQMLQFSVRQLA
EVENGMNAVERLRHYGTELEEEAPAHTIEVRDSWPERGDIVFDRVEMRYRPKLPLVLRGLSMHVGGGERIGIIGR
TGAGKSSIVSALFRLVEVSGGSIAIDGLDISTLGLHDLRSRLAIIPQDPTLFRGTVRSNLDPFDEHSDLELWSAL
RQADLVPDDAAAADSSPSSASRVQLDSVVEEEGLNFSLGQRQLMALARALVRGSRIIVCDEATSSVDMETDDKIQ
RTMATAFRGRTVLCIAHRLKTIVGYDRVCVMDAGRIAELDEPRSLWLRGGIFRAMCDQSGIRLADFGDEGGGRLS
E
Coding >Ophio5|2845
ATGGCACGCTCTCTCGGCAAGAACGAGTCGGACGCGCCAGATGCCGCGAACATCCGTCAGTCTCTGGACTCGGAG
GTTCAGATTGAAAAAGCCCTGGACTCGGGTGAAGACGAAAAGATTGAGATCGATCAAGGCGGAAAGATCGACAAG
CAGACCGGCGAGCCAAACATCGACCCCCTAACAGCCACAAAGAGTCAGGCCACGGATGTGAGCCTGACCACGTTT
GCTCCTGTGCAGCGTCTGCAAAAGCCCCGAACATGGCGCGACCGTATCAATCCATTGCGATGGGGGCCTGTTCCC
GCCGCGCCAGACGAGCCCATTGTCTCTCGCGAGTACACGGCAGGCTTCTTCAGCCAGCTCACCTTTGAGTGGATG
ACACCTCTCATGATGGCCGGATACAAACGGCCCCTTGAACGCCGCGACATTTGGACCGTCAACCCGGACCGGGCT
GTCGAGCCCCTGGCCGACCGAGTTCGGGATTCCATGCGACGACGCATTCAAAGTGGCCAAAAGTACCCTCTCCTC
TGGGCCCTCCACGAAACTCTCTTCCTCGAGTTTTGGCTCGGCGGCCTCTTCGCCTTCGTCGGCTTCCTCCCCCAG
GTCCTCGCCCCCTTTACCCTCCGCTACCTCATCCAGTTCGCCGCCGATGCCTACCACGCTCACGTCTCGAACCGG
CCGCCGCCTCCCATCGGCCATGGTATCGGCCTCGTTCTCGGAATCACGGCCATGCAGCTGTTGCAGTCCGTGTGC
ATCAACCACTTCATCTACCGTGGCATGATGATGGGCGGCGAGAGTCGCGGCCTTCTCATCAGCCTGATTTATGAA
AAGGCCATGGTCATATCGGGCCGTGCCCGCGCCGGCGATGTGCGCGACGGTCGTCAGGAGAAGCGGCAGCAAGAC
GGTCAAAAGCCCAAAAAGAAGCAAAAGGGGGCCAAGGACGGCATCGGCTGGGCCAACGGCCGTATTGTCAACCTC
ATGAGCGTCGACACCTACCGCATTGATCAAGCATCTAGCTTGGGCCACATGATCTGGGCTGGACCCATCCTCTGT
CTCATCACCCTCGTCCTTCTCCTCATCAATCTCACTTACAGCGCCCTCGCCGGTTATGGCCTGCTCGTCATCGGC
ATCCCCGCGCTGACCAGGGCCATCCGAAGCCTATTTCGCCGCCGTAGCCAGATCAACAAAATCACCGACCAGCGC
GTCTCTCTCACCCAAGAGATTCTTCAGTCGGTTCGCTTCGTCAAGTTCTTCGGCTGGGAAAAGGCCTTTACCGAC
CGTCTCGGCCAGATCCGGTCACGGGAGATTTATTCCATTCAGGTTCTACTGGCCATCCGCAACGGCATCAACGCC
ATCAGCATGTCGCTGCCCGTCTTTGCGTCGATGCTATCCTTCATCACCTACTCTCTCACCAGCCATAGTCTATCC
CCGGCCCAGGTCTTCTCCTCTCTGGCCCTGTTTAACAGCCTCCGTATCCCGCTCAACCTGCTGCCCACCGTCTTG
GGTCAGGTAGTCGATGCCTGGTCCTCGCTCAAGCGCATCGAAGAGTTTCTTGGACAGGAAGAGCAGGATGAGGAC
TTGGACGTGGCCCCTGAGTGCGTCAATGCCATCGAGCTCCGCGCCGCCTCCTTCACCTGGGAGCGAACTCCTACG
CAGGATACTGCGGACAAGCAAGAAAGCCCCCGCTCGACATCCAAGGATGACACGGCCAGCACCCTTGTCGAGGAA
CGAGATCCCTATAAGCTGCAGGACCTCAACCTGGAGGCCGGTCGAAAGGAGCTGATTGCGGTGATTGGCTCGGTG
GGAAGCGGCAAGAGCTCGCTGCTCGCTGCTTTGGCCGGGGACATGCGCAAGACGAGCGGCGAAGTTGTCTTTGGC
GCGTCCAGGGCCTTTTGTCCGCAGTACGCCTGGGTGCAGAACTCAACGCTGAGAGATAATATCACATTCGGTCAG
GACATGGACAAGCGCTGGTACAAAAAGGTCATCAAGGCATGCGCTCTCCAGGCCGACCTCGATATGCTTCCCAAT
GGTGACCTGACTGAGATCGGCGAGCGCGGCATCACCATCTCGGGCGGGCAGAAGCAGCGGCTCAATATTGCCAGA
GCCATTTACTTTGACGCTGACGTCGTCCTCATGGACGACCCCTTGAGCGCCGTCGATGCCCATGTCGGTCGACAC
ATCTTTGACAGCGCCATTCTCGGCCTCCTCAAAGACAAATGCCGGATCCTGGCGACGCACCAGCTCTGGGTGCTC
AGCCGCTGTGACCGCATCGTCTGGATGGAAAGGGGCAAGATCCAGGCGGTGGGCACGTTTGACAGCCTCCTCCGG
GACTACCAGAGCTTCCGGACCCTGATGGAGACGACGGCCGAGGAGGGAGAAAAGGATGCTTCAGCTCCGGAGACG
GCCTTGACGACAGCAGCAGCTGCGGTGCCCGAGAAGGAAGAGAAAAAGGCCAAAAAGGGCGCGGCGCTGATGCAG
CAGGAAGAGAGGGCCGAGGCCGGCGTGCCGTGGTCCGTCTACGGCGCATACGTCTCGGCCTCTGGCTCTCTCTTC
AACGCGCCCCTGATCATCTTGTTGCTCCTCCTGTCGCAGGGCGCCAACATCATGACGAGCCTGTGGCTGTCGTAC
TGGACGTCGGACAGGTTTTCCATGTCCGAAGGCCAGTACATTGGCATCTACGCAGGGCTCGGCGGCGTCCAGGCT
CTCCTCATGTTTGCCATGTCCGTCGCCCTCTCCGTTCTCGGCACCAGAGCGTCCAAGGTGATGCTGCGCGATGCC
GTCAACCGCGTGCTGCGGGCGCCCATGTCCTTCTTCGACACGACGCCGTTGGGCCGCATCACGAACCGGTTCTCG
CGCGACGTCGACGTCCTCGACAACACGCTGACGGACAGCATGCGCATGTTCTTCTTCACGCTGGCCATGACGACG
GCCGTCTTTGCCCTCGTCATCGCTTTCTTCCCCTACTTTGCTATTGCCCTGGGGCCGCTGTACGTGCTCTACGTC
GTGGCGGCGTCCTACTACCGAGCGTCGGCGCGCGAGGTGAAGCGGTTCGAGTCGGTGCTCCGGTCTCACGTCTTC
GCCAAGTTCAGCGAGGGCCTCAGCGGCGTGGCCACGATCCGGGCGTACGGGCTGAGGGCTCGCTTCGTCGGGGAG
CTTCGGGCGGCCATCGACGACATGAACAGCGCCTACTATCTCACCTTTTCCAACCAGCGCTGGCTTTCGGTGCGG
CTGGACATGATTGGCAACATCCTCGTCTTCGTCGTCGGCCTCTTGGTGGTGACGTCGCGGTTCAGCGTCGACCCG
TCCATTGGCGGCCTCGTGCTGAGCTACATCGTATCCATTGTTCAGATGCTGCAGTTCTCGGTCCGGCAACTGGCC
GAGGTGGAAAACGGGATGAACGCGGTCGAGCGGCTGCGCCATTACGGGACCGAGCTCGAGGAGGAGGCGCCGGCG
CACACCATCGAGGTGCGCGACAGCTGGCCGGAAAGGGGCGACATCGTCTTTGACCGGGTCGAGATGCGCTATCGT
CCCAAGCTGCCGCTGGTGCTGCGAGGCCTCTCGATGCACGTCGGCGGCGGGGAGCGCATCGGCATCATCGGCCGG
ACCGGCGCCGGCAAGAGCTCCATCGTCTCAGCGCTCTTCCGGCTGGTCGAGGTATCAGGGGGAAGCATCGCCATC
GACGGGCTGGACATTTCGACGCTCGGGCTGCACGATCTGAGATCCAGGCTGGCCATCATTCCGCAGGACCCTACA
CTTTTCCGCGGTACGGTGCGCAGCAACCTCGACCCCTTTGACGAGCACAGCGACCTCGAGCTATGGTCTGCGCTG
CGGCAGGCGGACCTCGTACCGGACGATGCGGCGGCGGCCGATTCGTCTCCGTCGTCGGCGTCGCGCGTCCAGCTC
GACAGCGTGGTCGAGGAAGAAGGGCTCAACTTCTCGCTCGGCCAGCGACAGCTCATGGCGCTGGCGCGCGCCCTC
GTCCGCGGCTCGCGCATCATCGTCTGCGACGAGGCCACGTCGTCGGTCGACATGGAGACGGACGACAAGATCCAG
CGGACCATGGCGACGGCCTTTCGCGGCCGGACCGTGCTGTGCATCGCCCATCGACTCAAGACCATTGTCGGCTAC
GATCGCGTCTGCGTCATGGACGCCGGCCGTATCGCCGAGCTGGACGAGCCGCGCTCCTTGTGGCTTCGTGGCGGC
ATCTTTCGCGCCATGTGCGACCAGAGTGGGATCCGTCTCGCTGACTTTGGCGACGAGGGGGGTGGGAGGTTGTCC
GAG
Transcript >Ophio5|2845
ATGGCACGCTCTCTCGGCAAGAACGAGTCGGACGCGCCAGATGCCGCGAACATCCGTCAGTCTCTGGACTCGGAG
GTTCAGATTGAAAAAGCCCTGGACTCGGGTGAAGACGAAAAGATTGAGATCGATCAAGGCGGAAAGATCGACAAG
CAGACCGGCGAGCCAAACATCGACCCCCTAACAGCCACAAAGAGTCAGGCCACGGATGTGAGCCTGACCACGTTT
GCTCCTGTGCAGCGTCTGCAAAAGCCCCGAACATGGCGCGACCGTATCAATCCATTGCGATGGGGGCCTGTTCCC
GCCGCGCCAGACGAGCCCATTGTCTCTCGCGAGTACACGGCAGGCTTCTTCAGCCAGCTCACCTTTGAGTGGATG
ACACCTCTCATGATGGCCGGATACAAACGGCCCCTTGAACGCCGCGACATTTGGACCGTCAACCCGGACCGGGCT
GTCGAGCCCCTGGCCGACCGAGTTCGGGATTCCATGCGACGACGCATTCAAAGTGGCCAAAAGTACCCTCTCCTC
TGGGCCCTCCACGAAACTCTCTTCCTCGAGTTTTGGCTCGGCGGCCTCTTCGCCTTCGTCGGCTTCCTCCCCCAG
GTCCTCGCCCCCTTTACCCTCCGCTACCTCATCCAGTTCGCCGCCGATGCCTACCACGCTCACGTCTCGAACCGG
CCGCCGCCTCCCATCGGCCATGGTATCGGCCTCGTTCTCGGAATCACGGCCATGCAGCTGTTGCAGTCCGTGTGC
ATCAACCACTTCATCTACCGTGGCATGATGATGGGCGGCGAGAGTCGCGGCCTTCTCATCAGCCTGATTTATGAA
AAGGCCATGGTCATATCGGGCCGTGCCCGCGCCGGCGATGTGCGCGACGGTCGTCAGGAGAAGCGGCAGCAAGAC
GGTCAAAAGCCCAAAAAGAAGCAAAAGGGGGCCAAGGACGGCATCGGCTGGGCCAACGGCCGTATTGTCAACCTC
ATGAGCGTCGACACCTACCGCATTGATCAAGCATCTAGCTTGGGCCACATGATCTGGGCTGGACCCATCCTCTGT
CTCATCACCCTCGTCCTTCTCCTCATCAATCTCACTTACAGCGCCCTCGCCGGTTATGGCCTGCTCGTCATCGGC
ATCCCCGCGCTGACCAGGGCCATCCGAAGCCTATTTCGCCGCCGTAGCCAGATCAACAAAATCACCGACCAGCGC
GTCTCTCTCACCCAAGAGATTCTTCAGTCGGTTCGCTTCGTCAAGTTCTTCGGCTGGGAAAAGGCCTTTACCGAC
CGTCTCGGCCAGATCCGGTCACGGGAGATTTATTCCATTCAGGTTCTACTGGCCATCCGCAACGGCATCAACGCC
ATCAGCATGTCGCTGCCCGTCTTTGCGTCGATGCTATCCTTCATCACCTACTCTCTCACCAGCCATAGTCTATCC
CCGGCCCAGGTCTTCTCCTCTCTGGCCCTGTTTAACAGCCTCCGTATCCCGCTCAACCTGCTGCCCACCGTCTTG
GGTCAGGTAGTCGATGCCTGGTCCTCGCTCAAGCGCATCGAAGAGTTTCTTGGACAGGAAGAGCAGGATGAGGAC
TTGGACGTGGCCCCTGAGTGCGTCAATGCCATCGAGCTCCGCGCCGCCTCCTTCACCTGGGAGCGAACTCCTACG
CAGGATACTGCGGACAAGCAAGAAAGCCCCCGCTCGACATCCAAGGATGACACGGCCAGCACCCTTGTCGAGGAA
CGAGATCCCTATAAGCTGCAGGACCTCAACCTGGAGGCCGGTCGAAAGGAGCTGATTGCGGTGATTGGCTCGGTG
GGAAGCGGCAAGAGCTCGCTGCTCGCTGCTTTGGCCGGGGACATGCGCAAGACGAGCGGCGAAGTTGTCTTTGGC
GCGTCCAGGGCCTTTTGTCCGCAGTACGCCTGGGTGCAGAACTCAACGCTGAGAGATAATATCACATTCGGTCAG
GACATGGACAAGCGCTGGTACAAAAAGGTCATCAAGGCATGCGCTCTCCAGGCCGACCTCGATATGCTTCCCAAT
GGTGACCTGACTGAGATCGGCGAGCGCGGCATCACCATCTCGGGCGGGCAGAAGCAGCGGCTCAATATTGCCAGA
GCCATTTACTTTGACGCTGACGTCGTCCTCATGGACGACCCCTTGAGCGCCGTCGATGCCCATGTCGGTCGACAC
ATCTTTGACAGCGCCATTCTCGGCCTCCTCAAAGACAAATGCCGGATCCTGGCGACGCACCAGCTCTGGGTGCTC
AGCCGCTGTGACCGCATCGTCTGGATGGAAAGGGGCAAGATCCAGGCGGTGGGCACGTTTGACAGCCTCCTCCGG
GACTACCAGAGCTTCCGGACCCTGATGGAGACGACGGCCGAGGAGGGAGAAAAGGATGCTTCAGCTCCGGAGACG
GCCTTGACGACAGCAGCAGCTGCGGTGCCCGAGAAGGAAGAGAAAAAGGCCAAAAAGGGCGCGGCGCTGATGCAG
CAGGAAGAGAGGGCCGAGGCCGGCGTGCCGTGGTCCGTCTACGGCGCATACGTCTCGGCCTCTGGCTCTCTCTTC
AACGCGCCCCTGATCATCTTGTTGCTCCTCCTGTCGCAGGGCGCCAACATCATGACGAGCCTGTGGCTGTCGTAC
TGGACGTCGGACAGGTTTTCCATGTCCGAAGGCCAGTACATTGGCATCTACGCAGGGCTCGGCGGCGTCCAGGCT
CTCCTCATGTTTGCCATGTCCGTCGCCCTCTCCGTTCTCGGCACCAGAGCGTCCAAGGTGATGCTGCGCGATGCC
GTCAACCGCGTGCTGCGGGCGCCCATGTCCTTCTTCGACACGACGCCGTTGGGCCGCATCACGAACCGGTTCTCG
CGCGACGTCGACGTCCTCGACAACACGCTGACGGACAGCATGCGCATGTTCTTCTTCACGCTGGCCATGACGACG
GCCGTCTTTGCCCTCGTCATCGCTTTCTTCCCCTACTTTGCTATTGCCCTGGGGCCGCTGTACGTGCTCTACGTC
GTGGCGGCGTCCTACTACCGAGCGTCGGCGCGCGAGGTGAAGCGGTTCGAGTCGGTGCTCCGGTCTCACGTCTTC
GCCAAGTTCAGCGAGGGCCTCAGCGGCGTGGCCACGATCCGGGCGTACGGGCTGAGGGCTCGCTTCGTCGGGGAG
CTTCGGGCGGCCATCGACGACATGAACAGCGCCTACTATCTCACCTTTTCCAACCAGCGCTGGCTTTCGGTGCGG
CTGGACATGATTGGCAACATCCTCGTCTTCGTCGTCGGCCTCTTGGTGGTGACGTCGCGGTTCAGCGTCGACCCG
TCCATTGGCGGCCTCGTGCTGAGCTACATCGTATCCATTGTTCAGATGCTGCAGTTCTCGGTCCGGCAACTGGCC
GAGGTGGAAAACGGGATGAACGCGGTCGAGCGGCTGCGCCATTACGGGACCGAGCTCGAGGAGGAGGCGCCGGCG
CACACCATCGAGGTGCGCGACAGCTGGCCGGAAAGGGGCGACATCGTCTTTGACCGGGTCGAGATGCGCTATCGT
CCCAAGCTGCCGCTGGTGCTGCGAGGCCTCTCGATGCACGTCGGCGGCGGGGAGCGCATCGGCATCATCGGCCGG
ACCGGCGCCGGCAAGAGCTCCATCGTCTCAGCGCTCTTCCGGCTGGTCGAGGTATCAGGGGGAAGCATCGCCATC
GACGGGCTGGACATTTCGACGCTCGGGCTGCACGATCTGAGATCCAGGCTGGCCATCATTCCGCAGGACCCTACA
CTTTTCCGCGGTACGGTGCGCAGCAACCTCGACCCCTTTGACGAGCACAGCGACCTCGAGCTATGGTCTGCGCTG
CGGCAGGCGGACCTCGTACCGGACGATGCGGCGGCGGCCGATTCGTCTCCGTCGTCGGCGTCGCGCGTCCAGCTC
GACAGCGTGGTCGAGGAAGAAGGGCTCAACTTCTCGCTCGGCCAGCGACAGCTCATGGCGCTGGCGCGCGCCCTC
GTCCGCGGCTCGCGCATCATCGTCTGCGACGAGGCCACGTCGTCGGTCGACATGGAGACGGACGACAAGATCCAG
CGGACCATGGCGACGGCCTTTCGCGGCCGGACCGTGCTGTGCATCGCCCATCGACTCAAGACCATTGTCGGCTAC
GATCGCGTCTGCGTCATGGACGCCGGCCGTATCGCCGAGCTGGACGAGCCGCGCTCCTTGTGGCTTCGTGGCGGC
ATCTTTCGCGCCATGTGCGACCAGAGTGGGATCCGTCTCGCTGACTTTGGCGACGAGGGGGGTGGGAGGTTGTCC
GAGTGA
Gene >Ophio5|2845
ATGGCACGCTCTCTCGGCAAGAACGAGTCGGACGCGCCAGATGCCGCGAACATCCGTCAGTCTCTGGACTCGGAG
GTTCAGATTGAAAAAGCCCTGGACTCGGGTGAAGACGAAAAGATTGAGATCGATCAAGGCGGAAAGATCGACAAG
CAGACCGGCGAGCCAAACATCGACCCCCTAACAGCCACAAAGAGTCAGGCCACGGATGTGAGCCTGACCACGTTT
GCTCCTGTGCAGCGTCTGCAAAAGCCCCGAACATGGCGCGACCGTATCAATCCATTGCGATGGGGGCCTGTTCCC
GCCGCGCCAGACGAGCCCATTGTCTCTCGCGAGTACACGGCAGGCTTCTTCAGCCAGCTCACCTTTGAGTGGATG
ACACCTCTCATGATGGTACGAGCAACCACATGTGCAGCGACTTGATCGCGTCGGTGAATCGCAGCTGACCCTAGT
TGTCCACTTAGGCCGGATACAAACGGCCCCTTGAACGCCGCGACATTTGGACCGTCAACCCGGACCGGGCTGTCG
AGCCCCTGGCCGACCGAGTTCGGGATTCCATGCGACGACGCATTCAAAGTGGCCAAAAGTACCCTCTCCTCTGGG
CCCTCCACGAAACTCTCTTCCTCGAGTTTTGGCTCGGCGGCCTCTTCGCCTTCGTCGGCTTCCTCCCCCAGGTCC
TCGCCCCCTTTACCCTCCGCTACCTCATCCAGTTCGCCGCCGATGCCTACCACGCTCACGTCTCGAACCGGCCGC
CGCCTCCCATCGGCCATGGTATCGGCCTCGTTCTCGGAATCACGGCCATGCAGCTGTTGCAGTCCGTGTGCATCA
ACCACTTCATCTACCGTGGCATGATGATGGGCGGCGAGAGTCGCGGCCTTCTCATCAGCCTGATTTATGAAAAGG
CCATGGTCATATCGGGCCGTGCCCGCGCCGGCGATGTGCGCGACGGTCGTCAGGAGAAGCGGCAGCAAGACGGTC
AAAAGCCCAAAAAGAAGCAAAAGGGGGCCAAGGACGGCATCGGCTGGGCCAACGGCCGTATTGTCAACCTCATGA
GCGTCGACACCTACCGCATTGATCAAGCATCTAGCTTGGGCCACATGATCTGGGCTGGACCCATCCTCTGTCTCA
TCACCCTCGTCCTTCTCCTCATCAATCTCACTTACAGCGCCCTCGCCGGTTATGGCCTGCTCGTCATCGGCATCC
CCGCGCTGACCAGGGCCATCCGAAGCCTATTTCGCCGCCGTAGCCAGATCAACAAAATCACCGACCAGCGCGTCT
CTCTCACCCAAGAGATTCTTCAGTCGGTTCGCTTCGTCAAGTTCTTCGGCTGGGAAAAGGCCTTTACCGACCGTC
TCGGCCAGATCCGGTCACGGGAGATTTATTCCATTCAGGTTCTACTGGCCATCCGCAACGGCATCAACGCCATCA
GCATGTCGCTGCCCGTCTTTGCGTCGATGCTATCCTTCATCACCTACTCTCTCACCAGCCATAGTCTATCCCCGG
CCCAGGTCTTCTCCTCTCTGGCCCTGTTTAACAGCCTCCGTATCCCGCTCAACCTGCTGCCCACCGTCTTGGGTC
AGGTAGTCGATGCCTGGTCCTCGCTCAAGCGCATCGAAGAGTTTCTTGGACAGGAAGAGCAGGATGAGGACTTGG
ACGTGGCCCCTGAGTGCGTCAATGCCATCGAGCTCCGCGCCGCCTCCTTCACCTGGGAGCGAACTCCTACGCAGG
ATACTGCGGACAAGCAAGAAAGCCCCCGCTCGACATCCAAGGATGACACGGCCAGCACCCTTGTCGAGGAACGAG
ATCCCTATAAGCTGCAGGACCTCAACCTGGAGGCCGGTCGAAAGGAGCTGATTGCGGTGATTGGCTCGGTGGGAA
GCGGCAAGAGCTCGCTGCTCGCTGCTTTGGCCGGGGACATGCGCAAGACGAGCGGCGAAGTTGTCTTTGGCGCGT
CCAGGGCCTTTTGTCCGCAGTACGCCTGGGTGCAGAACTCAACGCTGAGAGATAATATCACATTCGGTCAGGACA
TGGACAAGCGCTGGTACAAAAAGGTCATCAAGGCGTGAGTTGACGTGAGCCCTGTCTGACGAGAATGTGAGCTGA
CGACTTACCGCAGATGCGCTCTCCAGGCCGACCTCGATATGCTTCCCAATGGTGACCTGACTGAGATCGGCGAGC
GCGGCATCACCATCTCGGGCGGGCAGAAGCAGCGGCTCAATATTGCCAGAGCCATTTACTTTGACGCTGACGTCG
TCCTCATGGACGACCCCTTGAGCGCCGTCGATGCCCATGTCGGTCGACACATCTTTGACAGCGCCATTCTCGGCC
TCCTCAAAGACAAATGCCGGATCCTGGCGACGCACCAGCTCTGGGTGCTCAGCCGCTGTGACCGCATCGTCTGGA
TGGAAAGGGGCAAGATCCAGGCGGTGGGCACGTTTGACAGCCTCCTCCGGGACTACCAGAGCTTCCGGACCCTGA
TGGAGACGACGGCCGAGGAGGGAGAAAAGGATGCTTCAGCTCCGGAGACGGCCTTGACGACAGCAGCAGCTGCGG
TGCCCGAGAAGGAAGAGAAAAAGGCCAAAAAGGGCGCGGCGCTGATGCAGCAGGAAGAGAGGGCCGAGGCCGGCG
TGCCGTGGTCCGTCTACGGCGCATACGTCTCGGCCTCTGGCTCTCTCTTCAACGCGCCCCTGATCATCTTGTTGC
TCCTCCTGTCGCAGGGCGCCAACATCATGACGAGCCTGTGGCTGTCGTACTGGACGTCGGACAGGTTTTCCATGT
CCGAAGGCCAGTACATTGGCATCTACGCAGGGCTCGGCGGCGTCCAGGCTCTCCTCATGTTTGCCATGTCCGTCG
CCCTCTCCGTTCTCGGCACCAGAGCGTCCAAGGTGATGCTGCGCGATGCCGTCAACCGCGTGCTGCGGGCGCCCA
TGTCCTTCTTCGACACGACGCCGTTGGGCCGCATCACGAACCGGTTCTCGCGCGACGTCGACGTCCTCGACAACA
CGCTGACGGACAGCATGCGCATGTTCTTCTTCACGCTGGCCATGACGACGGCCGTCTTTGCCCTCGTCATCGCTT
TCTTCCCCTACTTTGCTATTGCCCTGGGGCCGCTGTACGTGCTCTACGTCGTGGCGGCGTCCTACTACCGAGCGT
CGGCGCGCGAGGTGAAGCGGTTCGAGTCGGTGCTCCGGTCTCACGTCTTCGCCAAGTTCAGCGAGGGCCTCAGCG
GCGTGGCCACGATCCGGGCGTACGGGCTGAGGGCTCGCTTCGTCGGGGAGCTTCGGGCGGCCATCGACGACATGA
ACAGCGCCTACTATCTCACCTTTTCCAACCAGCGCTGGCTTTCGGTGCGGCTGGACATGATTGGCAACATCCTCG
TCTTCGTCGTCGGCCTCTTGGTGGTGACGTCGCGGTTCAGCGTCGACCCGTCCATTGGCGGCCTCGTGCTGAGCT
ACATCGTATCCATTGTTCAGATGCTGCAGTTCTCGGTCCGGCAACTGGCCGAGGTGGAAAACGGGATGAACGCGG
TCGAGCGGCTGCGCCATTACGGGACCGAGCTCGAGGAGGAGGCGCCGGCGCACACCATCGAGGTGCGCGACAGCT
GGCCGGAAAGGGGCGACATCGTCTTTGACCGGGTCGAGATGCGCTATCGTCCCAAGCTGCCGCTGGTGCTGCGAG
GCCTCTCGATGCACGTCGGCGGCGGGGAGCGCATCGGCATCATCGGCCGGACCGGCGCCGGCAAGAGCTCCATCG
TCTCAGCGCTCTTCCGGCTGGTCGAGGTATCAGGGGGAAGCATCGCCATCGACGGGCTGGACATTTCGACGCTCG
GGCTGCACGATCTGAGATCCAGGCTGGCCATCATTCCGCAGGACCCTACACTTTTCCGCGGTACGGTGCGCAGCA
ACCTCGACCCCTTTGACGAGCACAGCGACCTCGAGCTATGGTCTGCGCTGCGGCAGGCGGACCTCGTACCGGACG
ATGCGGCGGCGGCCGATTCGTCTCCGTCGTCGGCGTCGCGCGTCCAGCTCGACAGCGTGGTCGAGGAAGAAGGGC
TCAACTTCTCGCTCGGCCAGCGACAGCTCATGGCGCTGGCGCGCGCCCTCGTCCGCGGCTCGCGCATCATCGTCT
GCGACGAGGCCACGTCGTCGGTCGACATGGAGACGGACGACAAGATCCAGCGGACCATGGCGACGGCCTTTCGCG
GCCGGACCGTGCTGTGCATCGCCCATCGACTCAAGACCATTGTCGGCTACGATCGCGTCTGCGTCATGGACGCCG
GCCGTATCGCCGAGCTGGACGAGCCGCGCTCCTTGTGGCTTCGTGGCGGCATCTTTCGCGCCATGTGCGACCAGA
GTGGGATCCGTCTCGCTGACTTTGGCGACGAGGGGGGTGGGAGGTTGTCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail