Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2836
Gene name
Locationscaffold_228:6761..7247
Strand+
Gene length (bp)486
Transcript length (bp)324
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08293 MRP-S33 Mitochondrial ribosomal subunit S27 1.7E-31 6 93

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53305|RT27_YEAST Mitochondrial 37S ribosomal protein S27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM27 PE=1 SV=1 1 93 6.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2836
MSVPRARLLDLLKAQCQIFATTYNPEGIRMGNKVLRQRLKGPALSSYYPRKLATIKDVKREFGPHLTTWDEAEED
RLDYIEELKERGKSAPKKKRTGRVSSFRKKKR
Coding >Ophio5|2836
ATGAGCGTCCCTCGCGCTCGGCTACTGGATCTTTTGAAGGCGCAATGCCAGATCTTCGCGACGACGTACAATCCC
GAGGGAATCCGCATGGGCAACAAAGTCTTACGACAGCGCTTGAAAGGTCCCGCGCTATCTTCCTACTACCCGAGG
AAACTGGCGACCATCAAGGATGTGAAGCGCGAGTTTGGCCCACACCTCACTACCTGGGACGAGGCCGAAGAGGAC
CGGCTCGACTACATAGAAGAATTGAAAGAGCGCGGCAAAAGTGCACCCAAAAAGAAGAGGACCGGTCGTGTTTCG
TCCTTTAGGAAGAAGAAACGT
Transcript >Ophio5|2836
ATGAGCGTCCCTCGCGCTCGGCTACTGGATCTTTTGAAGGCGCAATGCCAGATCTTCGCGACGACGTACAATCCC
GAGGGAATCCGCATGGGCAACAAAGTCTTACGACAGCGCTTGAAAGGTCCCGCGCTATCTTCCTACTACCCGAGG
AAACTGGCGACCATCAAGGATGTGAAGCGCGAGTTTGGCCCACACCTCACTACCTGGGACGAGGCCGAAGAGGAC
CGGCTCGACTACATAGAAGAATTGAAAGAGCGCGGCAAAAGTGCACCCAAAAAGAAGAGGACCGGTCGTGTTTCG
TCCTTTAGGAAGAAGAAACGTTAA
Gene >Ophio5|2836
ATGAGCGTCCCTCGCGCTCGGCTACTGGATCTTTTGAAGGCAACATATCTTCCGTCTACATTGACTACTCTGTCA
CTGACGCTCAGCTTCAGGCGCAATGCCAGATCTTCGCGACGACGTACAATCCCGAGGGAATCCGCATGGGCAACA
AAGTCTTACGACAGCGCTTGAAAGGTCCCGCGCTATCTTCCTACTACCCGAGGAAACTGGCGACCATCAAGGATG
TGAAGCGCGAGTTTGGCCCACACCTCACTACCTGGGACGAGGCCGAAGAGGACCGGCTCGACTACATAGAAGAGT
AAGGACGCCCAGCGTGCAGGTGTCGAGCGCGGCCTGCTAACTCGCCATTTATAGATTGAAAGAGCGCGGCAAAAG
TGCACCCAAAAAGAAGAGGACCGGTCGTGGTAGGCTTACATGTCATGACCCTCGCGAGCCCGATTGCTAACCGTT
GTAATAGTTTCGTCCTTTAGGAAGAAGAAACGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail