Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2834
Gene name
Locationscaffold_228:4153..5098
Strand-
Gene length (bp)945
Transcript length (bp)828
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00887 ACBP Acyl CoA binding protein 1.5E-23 6 94

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C4R8D7|ATG37_PICPG Autophagy-related protein 37 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0602 PE=1 SV=1 1 149 8.0E-32
sp|Q20507|ACBP3_CAEEL Acyl-CoA-binding protein homolog 3 OS=Caenorhabditis elegans GN=acbp-3 PE=3 SV=2 4 107 2.0E-09
sp|P0C8L7|ACBP_HYPDU Putative acyl-CoA-binding protein OS=Hypsibius dujardini PE=3 SV=1 4 100 5.0E-08
sp|Q3SZF0|ACBD7_BOVIN Acyl-CoA-binding domain-containing protein 7 OS=Bos taurus GN=ACBD7 PE=3 SV=1 25 102 7.0E-06

GO

GO Term Description Terminal node
GO:0000062 fatty-acyl-CoA binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0120227 acyl-CoA binding No
GO:1901363 heterocyclic compound binding No
GO:1901567 fatty acid derivative binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0033218 amide binding No
GO:1901681 sulfur compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 222 244 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2834
MADSVDRVFVHALNTVKKIPKTGASRPPPSDRLRLYGLYKQAMEGDVDGVMEQPAPTPALTAEELQRERDKWHAW
NSQKGLGRTEAKRRYVEALIQTMHRYATTTDATELVAELEFVWNQIRHNSSGSSDYSPPTAAARLQQDGPMNVLT
PMSEQGEAEMRSHRQMELHGSGAAEQSGRWQRTIDRAVTNLSAEVAALREQIATGREWKSKKERSFSAWLRWMAW
KVIKHIVADCVVVALVLLWMRRRRDTRLEDLVRAVLKLAREYARKVLPSR
Coding >Ophio5|2834
ATGGCCGACTCCGTGGATCGAGTCTTCGTTCACGCTCTCAACACCGTCAAGAAGATACCCAAGACGGGCGCGTCG
CGGCCGCCGCCGTCAGACCGCCTGCGCCTCTATGGGCTCTACAAACAGGCCATGGAGGGCGACGTCGACGGTGTC
ATGGAGCAGCCTGCGCCGACGCCCGCGCTGACGGCTGAAGAGTTGCAGCGGGAGCGAGACAAGTGGCATGCCTGG
AACTCCCAGAAGGGTCTTGGCCGTACCGAGGCCAAGCGGAGATATGTCGAAGCCCTCATTCAGACCATGCACCGC
TACGCCACCACTACGGATGCTACCGAGCTCGTGGCTGAGCTCGAGTTCGTCTGGAACCAGATCAGGCACAACTCG
TCCGGCTCGTCCGACTACTCACCGCCGACGGCAGCCGCGAGACTCCAGCAGGACGGTCCGATGAACGTGCTGACG
CCCATGAGCGAGCAGGGCGAGGCCGAGATGCGGTCACATCGGCAGATGGAGCTCCACGGCTCCGGGGCGGCCGAG
CAGAGCGGTCGCTGGCAAAGAACCATAGACCGCGCCGTCACCAACCTGTCCGCCGAGGTAGCGGCGCTGCGGGAG
CAGATCGCGACAGGGAGGGAGTGGAAGTCGAAAAAGGAGCGCAGCTTCTCGGCTTGGCTCAGGTGGATGGCGTGG
AAAGTCATCAAGCACATCGTCGCTGACTGCGTCGTCGTCGCCCTCGTTCTGCTTTGGATGCGGAGACGAAGAGAT
ACGCGGCTGGAGGACCTCGTGAGGGCGGTGCTCAAGCTGGCCCGGGAATATGCTCGAAAGGTTCTCCCGTCCAGA
Transcript >Ophio5|2834
ATGGCCGACTCCGTGGATCGAGTCTTCGTTCACGCTCTCAACACCGTCAAGAAGATACCCAAGACGGGCGCGTCG
CGGCCGCCGCCGTCAGACCGCCTGCGCCTCTATGGGCTCTACAAACAGGCCATGGAGGGCGACGTCGACGGTGTC
ATGGAGCAGCCTGCGCCGACGCCCGCGCTGACGGCTGAAGAGTTGCAGCGGGAGCGAGACAAGTGGCATGCCTGG
AACTCCCAGAAGGGTCTTGGCCGTACCGAGGCCAAGCGGAGATATGTCGAAGCCCTCATTCAGACCATGCACCGC
TACGCCACCACTACGGATGCTACCGAGCTCGTGGCTGAGCTCGAGTTCGTCTGGAACCAGATCAGGCACAACTCG
TCCGGCTCGTCCGACTACTCACCGCCGACGGCAGCCGCGAGACTCCAGCAGGACGGTCCGATGAACGTGCTGACG
CCCATGAGCGAGCAGGGCGAGGCCGAGATGCGGTCACATCGGCAGATGGAGCTCCACGGCTCCGGGGCGGCCGAG
CAGAGCGGTCGCTGGCAAAGAACCATAGACCGCGCCGTCACCAACCTGTCCGCCGAGGTAGCGGCGCTGCGGGAG
CAGATCGCGACAGGGAGGGAGTGGAAGTCGAAAAAGGAGCGCAGCTTCTCGGCTTGGCTCAGGTGGATGGCGTGG
AAAGTCATCAAGCACATCGTCGCTGACTGCGTCGTCGTCGCCCTCGTTCTGCTTTGGATGCGGAGACGAAGAGAT
ACGCGGCTGGAGGACCTCGTGAGGGCGGTGCTCAAGCTGGCCCGGGAATATGCTCGAAAGGTTCTCCCGTCCAGA
TGA
Gene >Ophio5|2834
ATGGCCGACTCCGTGGGTGCGTCGCCGGCTGGCCGGCCTGTGTGTCGAGTTGACTTTTGCGCTGACGGGTGCAGA
TCGAGTCTTCGTTCACGCTCTCAACACCGTCAAGAAGATACCCAAGACGGGCGCGTCGCGGCCGCCGCCGTCAGA
CCGCCTGCGCCTCTATGGGCTCTACAAACAGGCCATGGAGGGCGACGTCGACGGTGTCATGGAGCAGCCTGCGCC
GACGCCCGCGCTGACGGCTGAAGAGTTGCAGCGGGAGCGAGACAAGTGGCATGCCTGGAACTCCCAGAAGGGTCT
TGGCCGTACCGAGGCCAAGCGGAGATATGTCGAAGCCCTCATTCAGACCATGCACCGCTACGCCACCACTACGTC
GGTCACAAAGTCCAACCCCTTACCACCATCCCGTTTTGCTGACGCGAGGCGTCCAGGGATGCTACCGAGCTCGTG
GCTGAGCTCGAGTTCGTCTGGAACCAGATCAGGCACAACTCGTCCGGCTCGTCCGACTACTCACCGCCGACGGCA
GCCGCGAGACTCCAGCAGGACGGTCCGATGAACGTGCTGACGCCCATGAGCGAGCAGGGCGAGGCCGAGATGCGG
TCACATCGGCAGATGGAGCTCCACGGCTCCGGGGCGGCCGAGCAGAGCGGTCGCTGGCAAAGAACCATAGACCGC
GCCGTCACCAACCTGTCCGCCGAGGTAGCGGCGCTGCGGGAGCAGATCGCGACAGGGAGGGAGTGGAAGTCGAAA
AAGGAGCGCAGCTTCTCGGCTTGGCTCAGGTGGATGGCGTGGAAAGTCATCAAGCACATCGTCGCTGACTGCGTC
GTCGTCGCCCTCGTTCTGCTTTGGATGCGGAGACGAAGAGATACGCGGCTGGAGGACCTCGTGAGGGCGGTGCTC
AAGCTGGCCCGGGAATATGCTCGAAAGGTTCTCCCGTCCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail