Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2830
Gene name
Locationscaffold_227:24960..26796
Strand-
Gene length (bp)1836
Transcript length (bp)1836
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03068 PAD Protein-arginine deiminase (PAD) 8.9E-121 198 605

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ULW8|PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens GN=PADI3 PE=1 SV=2 199 605 3.0E-49
sp|P70708|PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus GN=Padi3 PE=2 SV=1 199 605 8.0E-48
sp|Q9Z184|PADI3_MOUSE Protein-arginine deiminase type-3 OS=Mus musculus GN=Padi3 PE=1 SV=2 199 605 3.0E-47
sp|O02849|PADI3_SHEEP Protein-arginine deiminase type-3 OS=Ovis aries GN=PADI3 PE=1 SV=1 28 606 7.0E-47
sp|Q9UM07|PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens GN=PADI4 PE=1 SV=2 200 605 3.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ULW8|PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens GN=PADI3 PE=1 SV=2 199 605 3.0E-49
sp|P70708|PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus GN=Padi3 PE=2 SV=1 199 605 8.0E-48
sp|Q9Z184|PADI3_MOUSE Protein-arginine deiminase type-3 OS=Mus musculus GN=Padi3 PE=1 SV=2 199 605 3.0E-47
sp|O02849|PADI3_SHEEP Protein-arginine deiminase type-3 OS=Ovis aries GN=PADI3 PE=1 SV=1 28 606 7.0E-47
sp|Q9UM07|PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens GN=PADI4 PE=1 SV=2 200 605 3.0E-45
sp|Q9ULC6|PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens GN=PADI1 PE=2 SV=2 199 605 8.0E-44
sp|O88807|PADI4_RAT Protein-arginine deiminase type-4 OS=Rattus norvegicus GN=Padi4 PE=2 SV=1 199 605 2.0E-43
sp|Q9Z183|PADI4_MOUSE Protein-arginine deiminase type-4 OS=Mus musculus GN=Padi4 PE=2 SV=3 199 605 3.0E-43
sp|O88806|PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus GN=Padi1 PE=2 SV=1 199 605 9.0E-41
sp|P20717|PADI2_RAT Protein-arginine deiminase type-2 OS=Rattus norvegicus GN=Padi2 PE=1 SV=1 199 605 1.0E-40
sp|Q9Y2J8|PADI2_HUMAN Protein-arginine deiminase type-2 OS=Homo sapiens GN=PADI2 PE=1 SV=2 199 605 4.0E-40
sp|Q08642|PADI2_MOUSE Protein-arginine deiminase type-2 OS=Mus musculus GN=Padi2 PE=1 SV=2 199 605 5.0E-40
sp|Q9Z185|PADI1_MOUSE Protein-arginine deiminase type-1 OS=Mus musculus GN=Padi1 PE=1 SV=1 199 605 1.0E-38
sp|Q6TGC4|PADI6_HUMAN Protein-arginine deiminase type-6 OS=Homo sapiens GN=PADI6 PE=1 SV=3 260 605 5.0E-30
sp|Q8K3V4|PADI6_MOUSE Protein-arginine deiminase type-6 OS=Mus musculus GN=Padi6 PE=1 SV=2 260 605 3.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0004668 protein-arginine deiminase activity Yes
GO:0005509 calcium ion binding Yes
GO:0005737 cytoplasm Yes
GO:0016787 hydrolase activity No
GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines No
GO:0046872 metal ion binding No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.58 0.0 1.21
CcL In ants, during behavior modification 0.29 0.0 0.75
CcD In ants, recently dead 0.00 0.0 0.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2830
MATFLRLTFLTAIIHSIHAAILQPHIRADTNRDGIVDVDGSSDSYDKTSWTPERGAIFLANIGDKTLRCFTQDAN
GNPLSENELALCNDAAGHLLLAPEYAAPLRTLPIDVSADATARIYATARAATERVRIFVLDDVSKPASTSSWRLV
DPEFSFNSTQLKSGIFLGLDGREPVIDAEVWDGSVTVCFDVRDGAERVSDKVALKMAPVLTHHHLQTVETLISVS
TGDTDQRFISQLDEARAAAGLKSPLLLINGTDDIWAQDFIEPAYTSMPGPDGPISLRIILRSPQSSRSAGRKVFE
QFRGPGIGGIQPLSGIGSGFGKRHINSLGNLETIPPYTSKDGVEYKAGRTIMGKHFGDMPAKSILGFLHGQRLQP
PLLLETGWLLVGHVDEFVQFVPYENDLGFTIAIADTRSAVRLMQELEKDGHGGVLACTYPANDIDMADVSDAGIG
VTISDLASNQTFLDGNAYAQKYMDANLEMLLAEIPLSPEDVIRVPTLFRTIDYLYPMGTDGTPRWKDPPPKGEKQ
VAAFNPEAINGIVIGKHYVSPKTFGPVVDGVDVLARATEAAYARAGMTVHYVDDFKSHHLSTGEVHCGSNTLRQT
DLIWWARGMKQ
Coding >Ophio5|2830
ATGGCAACCTTTCTACGCCTCACGTTCTTGACAGCCATCATCCATTCCATCCACGCGGCAATTTTGCAACCTCAT
ATTCGCGCGGACACCAACAGGGATGGAATCGTCGACGTCGACGGTTCCTCGGACTCGTACGACAAGACATCCTGG
ACCCCAGAGCGTGGAGCCATCTTCCTAGCGAATATCGGTGACAAGACTCTACGTTGCTTCACCCAGGACGCGAAT
GGGAATCCCCTGAGCGAAAATGAATTGGCATTATGCAACGATGCGGCGGGTCATCTTCTCCTTGCTCCGGAATAC
GCGGCGCCCCTTCGAACACTCCCTATCGACGTGTCGGCCGATGCCACGGCTCGGATTTACGCTACAGCTCGAGCG
GCGACGGAACGCGTTCGAATCTTTGTCCTCGATGACGTTTCCAAGCCGGCATCGACTTCGTCCTGGCGTCTCGTC
GATCCCGAGTTCTCCTTCAACTCGACCCAACTCAAGTCTGGTATCTTTCTCGGCTTGGACGGTAGAGAGCCTGTG
ATAGACGCTGAAGTTTGGGACGGTTCTGTCACTGTGTGTTTTGACGTCAGGGATGGCGCAGAGCGTGTCTCGGAC
AAGGTAGCTCTGAAGATGGCGCCGGTGCTCACCCATCATCACCTCCAAACAGTCGAGACCTTGATCAGTGTCTCT
ACAGGGGACACTGACCAACGTTTCATCAGCCAATTGGACGAAGCCAGGGCTGCGGCCGGTCTCAAAAGCCCCCTA
CTGCTCATCAACGGAACAGACGATATCTGGGCCCAGGACTTTATAGAGCCGGCCTACACAAGCATGCCCGGGCCA
GACGGTCCCATCTCGCTCCGTATAATACTTCGCTCACCACAGTCTAGCCGATCAGCAGGACGCAAGGTATTTGAG
CAGTTTCGCGGCCCGGGCATCGGAGGAATCCAACCCCTTAGCGGAATCGGATCTGGATTTGGCAAGCGTCACATC
AACAGCCTCGGAAACCTCGAGACGATTCCTCCCTACACCTCAAAGGATGGCGTCGAGTACAAGGCTGGCCGCACC
ATCATGGGCAAGCACTTTGGTGATATGCCTGCAAAGTCGATACTCGGCTTTCTACACGGACAGCGTCTGCAGCCT
CCTTTGCTACTCGAGACCGGCTGGCTCCTCGTCGGCCACGTAGACGAGTTCGTTCAGTTCGTCCCCTACGAAAAC
GATCTAGGCTTCACCATTGCCATTGCAGATACCAGGTCGGCAGTGCGTCTTATGCAGGAACTAGAGAAAGACGGC
CACGGCGGCGTCCTTGCCTGCACCTACCCAGCCAACGACATCGACATGGCCGACGTCAGCGACGCGGGCATAGGC
GTAACCATATCAGACCTCGCGAGCAACCAGACATTTCTAGATGGCAACGCCTACGCGCAGAAATACATGGACGCG
AACCTGGAGATGCTACTGGCCGAAATCCCTCTCTCCCCAGAGGACGTTATTCGTGTGCCTACCCTCTTCCGCACC
ATCGACTACCTATACCCGATGGGCACCGACGGGACTCCGCGGTGGAAGGACCCGCCTCCCAAAGGCGAGAAGCAA
GTGGCGGCCTTCAACCCAGAGGCCATCAACGGCATCGTCATCGGCAAGCACTACGTGAGCCCCAAGACGTTTGGA
CCGGTTGTCGACGGGGTGGATGTGCTTGCGAGAGCGACCGAGGCGGCGTACGCAAGGGCCGGGATGACGGTTCAC
TATGTTGATGATTTCAAGAGTCATCATCTGTCCACTGGCGAGGTTCATTGTGGGAGTAATACGCTGCGGCAGACT
GACTTGATTTGGTGGGCAAGGGGGATGAAGCAG
Transcript >Ophio5|2830
ATGGCAACCTTTCTACGCCTCACGTTCTTGACAGCCATCATCCATTCCATCCACGCGGCAATTTTGCAACCTCAT
ATTCGCGCGGACACCAACAGGGATGGAATCGTCGACGTCGACGGTTCCTCGGACTCGTACGACAAGACATCCTGG
ACCCCAGAGCGTGGAGCCATCTTCCTAGCGAATATCGGTGACAAGACTCTACGTTGCTTCACCCAGGACGCGAAT
GGGAATCCCCTGAGCGAAAATGAATTGGCATTATGCAACGATGCGGCGGGTCATCTTCTCCTTGCTCCGGAATAC
GCGGCGCCCCTTCGAACACTCCCTATCGACGTGTCGGCCGATGCCACGGCTCGGATTTACGCTACAGCTCGAGCG
GCGACGGAACGCGTTCGAATCTTTGTCCTCGATGACGTTTCCAAGCCGGCATCGACTTCGTCCTGGCGTCTCGTC
GATCCCGAGTTCTCCTTCAACTCGACCCAACTCAAGTCTGGTATCTTTCTCGGCTTGGACGGTAGAGAGCCTGTG
ATAGACGCTGAAGTTTGGGACGGTTCTGTCACTGTGTGTTTTGACGTCAGGGATGGCGCAGAGCGTGTCTCGGAC
AAGGTAGCTCTGAAGATGGCGCCGGTGCTCACCCATCATCACCTCCAAACAGTCGAGACCTTGATCAGTGTCTCT
ACAGGGGACACTGACCAACGTTTCATCAGCCAATTGGACGAAGCCAGGGCTGCGGCCGGTCTCAAAAGCCCCCTA
CTGCTCATCAACGGAACAGACGATATCTGGGCCCAGGACTTTATAGAGCCGGCCTACACAAGCATGCCCGGGCCA
GACGGTCCCATCTCGCTCCGTATAATACTTCGCTCACCACAGTCTAGCCGATCAGCAGGACGCAAGGTATTTGAG
CAGTTTCGCGGCCCGGGCATCGGAGGAATCCAACCCCTTAGCGGAATCGGATCTGGATTTGGCAAGCGTCACATC
AACAGCCTCGGAAACCTCGAGACGATTCCTCCCTACACCTCAAAGGATGGCGTCGAGTACAAGGCTGGCCGCACC
ATCATGGGCAAGCACTTTGGTGATATGCCTGCAAAGTCGATACTCGGCTTTCTACACGGACAGCGTCTGCAGCCT
CCTTTGCTACTCGAGACCGGCTGGCTCCTCGTCGGCCACGTAGACGAGTTCGTTCAGTTCGTCCCCTACGAAAAC
GATCTAGGCTTCACCATTGCCATTGCAGATACCAGGTCGGCAGTGCGTCTTATGCAGGAACTAGAGAAAGACGGC
CACGGCGGCGTCCTTGCCTGCACCTACCCAGCCAACGACATCGACATGGCCGACGTCAGCGACGCGGGCATAGGC
GTAACCATATCAGACCTCGCGAGCAACCAGACATTTCTAGATGGCAACGCCTACGCGCAGAAATACATGGACGCG
AACCTGGAGATGCTACTGGCCGAAATCCCTCTCTCCCCAGAGGACGTTATTCGTGTGCCTACCCTCTTCCGCACC
ATCGACTACCTATACCCGATGGGCACCGACGGGACTCCGCGGTGGAAGGACCCGCCTCCCAAAGGCGAGAAGCAA
GTGGCGGCCTTCAACCCAGAGGCCATCAACGGCATCGTCATCGGCAAGCACTACGTGAGCCCCAAGACGTTTGGA
CCGGTTGTCGACGGGGTGGATGTGCTTGCGAGAGCGACCGAGGCGGCGTACGCAAGGGCCGGGATGACGGTTCAC
TATGTTGATGATTTCAAGAGTCATCATCTGTCCACTGGCGAGGTTCATTGTGGGAGTAATACGCTGCGGCAGACT
GACTTGATTTGGTGGGCAAGGGGGATGAAGCAGTAG
Gene >Ophio5|2830
ATGGCAACCTTTCTACGCCTCACGTTCTTGACAGCCATCATCCATTCCATCCACGCGGCAATTTTGCAACCTCAT
ATTCGCGCGGACACCAACAGGGATGGAATCGTCGACGTCGACGGTTCCTCGGACTCGTACGACAAGACATCCTGG
ACCCCAGAGCGTGGAGCCATCTTCCTAGCGAATATCGGTGACAAGACTCTACGTTGCTTCACCCAGGACGCGAAT
GGGAATCCCCTGAGCGAAAATGAATTGGCATTATGCAACGATGCGGCGGGTCATCTTCTCCTTGCTCCGGAATAC
GCGGCGCCCCTTCGAACACTCCCTATCGACGTGTCGGCCGATGCCACGGCTCGGATTTACGCTACAGCTCGAGCG
GCGACGGAACGCGTTCGAATCTTTGTCCTCGATGACGTTTCCAAGCCGGCATCGACTTCGTCCTGGCGTCTCGTC
GATCCCGAGTTCTCCTTCAACTCGACCCAACTCAAGTCTGGTATCTTTCTCGGCTTGGACGGTAGAGAGCCTGTG
ATAGACGCTGAAGTTTGGGACGGTTCTGTCACTGTGTGTTTTGACGTCAGGGATGGCGCAGAGCGTGTCTCGGAC
AAGGTAGCTCTGAAGATGGCGCCGGTGCTCACCCATCATCACCTCCAAACAGTCGAGACCTTGATCAGTGTCTCT
ACAGGGGACACTGACCAACGTTTCATCAGCCAATTGGACGAAGCCAGGGCTGCGGCCGGTCTCAAAAGCCCCCTA
CTGCTCATCAACGGAACAGACGATATCTGGGCCCAGGACTTTATAGAGCCGGCCTACACAAGCATGCCCGGGCCA
GACGGTCCCATCTCGCTCCGTATAATACTTCGCTCACCACAGTCTAGCCGATCAGCAGGACGCAAGGTATTTGAG
CAGTTTCGCGGCCCGGGCATCGGAGGAATCCAACCCCTTAGCGGAATCGGATCTGGATTTGGCAAGCGTCACATC
AACAGCCTCGGAAACCTCGAGACGATTCCTCCCTACACCTCAAAGGATGGCGTCGAGTACAAGGCTGGCCGCACC
ATCATGGGCAAGCACTTTGGTGATATGCCTGCAAAGTCGATACTCGGCTTTCTACACGGACAGCGTCTGCAGCCT
CCTTTGCTACTCGAGACCGGCTGGCTCCTCGTCGGCCACGTAGACGAGTTCGTTCAGTTCGTCCCCTACGAAAAC
GATCTAGGCTTCACCATTGCCATTGCAGATACCAGGTCGGCAGTGCGTCTTATGCAGGAACTAGAGAAAGACGGC
CACGGCGGCGTCCTTGCCTGCACCTACCCAGCCAACGACATCGACATGGCCGACGTCAGCGACGCGGGCATAGGC
GTAACCATATCAGACCTCGCGAGCAACCAGACATTTCTAGATGGCAACGCCTACGCGCAGAAATACATGGACGCG
AACCTGGAGATGCTACTGGCCGAAATCCCTCTCTCCCCAGAGGACGTTATTCGTGTGCCTACCCTCTTCCGCACC
ATCGACTACCTATACCCGATGGGCACCGACGGGACTCCGCGGTGGAAGGACCCGCCTCCCAAAGGCGAGAAGCAA
GTGGCGGCCTTCAACCCAGAGGCCATCAACGGCATCGTCATCGGCAAGCACTACGTGAGCCCCAAGACGTTTGGA
CCGGTTGTCGACGGGGTGGATGTGCTTGCGAGAGCGACCGAGGCGGCGTACGCAAGGGCCGGGATGACGGTTCAC
TATGTTGATGATTTCAAGAGTCATCATCTGTCCACTGGCGAGGTTCATTGTGGGAGTAATACGCTGCGGCAGACT
GACTTGATTTGGTGGGCAAGGGGGATGAAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail