Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2813
Gene name
Locationscaffold_226:11901..13146
Strand-
Gene length (bp)1245
Transcript length (bp)1245
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 6.6E-11 8 175
PF01494 FAD_binding_3 FAD binding domain 2.3E-08 315 356

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01911|TETX_BACFG Tetracycline resistance protein from transposon Tn4351/Tn4400 OS=Bacteroides fragilis GN=tetX PE=4 SV=1 7 394 2.0E-35
sp|B2FL98|KMO_STRMK Kynurenine 3-monooxygenase OS=Stenotrophomonas maltophilia (strain K279a) GN=kmo PE=3 SV=1 8 373 1.0E-08
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 5 365 2.0E-07
sp|C3VEQ2|ZEP_ONCHC Zeaxanthin epoxidase, chloroplastic OS=Oncidium hybrid cultivar GN=ZEP PE=2 SV=1 106 411 1.0E-06

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7255 0.4431 0.3815 0.0348 0.1023 0.0306 0.089 0.038 0.1419 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4857
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4753
Ophiocordyceps camponoti-floridani Ophcf2|02422
Ophiocordyceps camponoti-rufipedis Ophun1|6768
Ophiocordyceps kimflemingae Ophio5|2813 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10975

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2813
MRGFRPRIAIAGGGPSGLALSLLLRRYGIGSTVYELRHKPRPEELAEPSGMLDLHEESGLTVMRECGLWEGFQAK
VGDCSEAMRVLRSDGVEVHADDGRGEPRPEIPRHGLIRLLAEKLPDDAVRWGSKVAAVRRSRNPETDAVEATVEL
AGSDSATYDLVIGADGAWSRVRALVSDTKPAYCGTQLVTATLRHASAHDPDLVDLSGSGSLWALGHGNALMTQRG
PQDSIRVYAAISSPDEHWASAVGLRGRTTSEAKTFLLGPGGPFSNWASPLQHLLATVCDADSQDHVGRAVDVMPL
YALPAGHLWSRNGGGATLIGDAAHLMLPFAGEGVNLALWDALDLARLLAEVSEAADAKAWQAGLEPRLRAMEERM
QARAQKKSEEARRNKEMMLGDGAADVVAAWFRRHQGSDG
Coding >Ophio5|2813
ATGCGCGGCTTTCGGCCTCGGATCGCCATCGCGGGCGGGGGCCCCTCCGGCCTGGCCCTGTCACTGCTCCTCCGA
CGATACGGCATCGGCAGCACCGTGTACGAACTGCGGCATAAGCCCCGGCCCGAGGAGCTGGCCGAGCCGTCAGGC
ATGCTGGACTTACACGAGGAGTCGGGCTTGACGGTGATGCGTGAATGTGGCCTGTGGGAGGGCTTCCAGGCAAAG
GTGGGCGACTGCTCAGAGGCAATGCGCGTCTTACGGTCGGACGGCGTCGAGGTTCACGCCGATGACGGCCGGGGC
GAGCCGCGGCCCGAAATTCCGCGTCACGGCCTCATCCGGCTGCTGGCGGAGAAGCTCCCCGATGATGCCGTCCGG
TGGGGCAGCAAGGTAGCAGCAGTGCGACGGAGCCGGAACCCGGAGACGGATGCAGTCGAGGCCACGGTCGAGCTC
GCCGGTAGCGACTCGGCCACTTACGACCTGGTCATCGGCGCCGATGGTGCTTGGTCGCGCGTGAGAGCTCTCGTC
TCGGACACGAAGCCGGCCTACTGCGGAACCCAACTGGTGACGGCGACGCTGCGCCACGCATCGGCCCATGACCCG
GACCTGGTCGACCTCAGCGGCTCCGGGTCACTCTGGGCGCTCGGTCACGGCAACGCGCTGATGACACAGCGCGGT
CCCCAAGACTCGATTCGCGTTTATGCGGCCATCAGCTCCCCGGACGAGCACTGGGCTTCCGCCGTCGGACTCCGG
GGCCGGACGACGAGCGAGGCCAAGACGTTTCTATTGGGTCCCGGCGGGCCATTCAGCAACTGGGCGTCACCGCTT
CAACACCTGCTGGCGACGGTCTGCGACGCCGACAGCCAGGACCACGTTGGCCGAGCCGTGGACGTCATGCCGCTG
TATGCGCTCCCAGCCGGCCATCTCTGGTCCCGGAACGGGGGCGGAGCGACGCTCATCGGCGATGCCGCCCACCTG
ATGCTTCCCTTTGCCGGCGAGGGCGTCAACCTCGCGCTTTGGGACGCCCTCGACCTCGCCCGATTGCTGGCCGAG
GTGTCTGAGGCAGCCGACGCAAAGGCTTGGCAGGCTGGACTGGAGCCGCGGCTGCGGGCCATGGAGGAGAGGATG
CAGGCCAGGGCGCAGAAGAAGTCCGAGGAGGCGAGACGCAACAAGGAGATGATGCTTGGCGACGGGGCAGCCGAC
GTAGTGGCAGCCTGGTTCAGGCGTCACCAGGGGTCGGACGGA
Transcript >Ophio5|2813
ATGCGCGGCTTTCGGCCTCGGATCGCCATCGCGGGCGGGGGCCCCTCCGGCCTGGCCCTGTCACTGCTCCTCCGA
CGATACGGCATCGGCAGCACCGTGTACGAACTGCGGCATAAGCCCCGGCCCGAGGAGCTGGCCGAGCCGTCAGGC
ATGCTGGACTTACACGAGGAGTCGGGCTTGACGGTGATGCGTGAATGTGGCCTGTGGGAGGGCTTCCAGGCAAAG
GTGGGCGACTGCTCAGAGGCAATGCGCGTCTTACGGTCGGACGGCGTCGAGGTTCACGCCGATGACGGCCGGGGC
GAGCCGCGGCCCGAAATTCCGCGTCACGGCCTCATCCGGCTGCTGGCGGAGAAGCTCCCCGATGATGCCGTCCGG
TGGGGCAGCAAGGTAGCAGCAGTGCGACGGAGCCGGAACCCGGAGACGGATGCAGTCGAGGCCACGGTCGAGCTC
GCCGGTAGCGACTCGGCCACTTACGACCTGGTCATCGGCGCCGATGGTGCTTGGTCGCGCGTGAGAGCTCTCGTC
TCGGACACGAAGCCGGCCTACTGCGGAACCCAACTGGTGACGGCGACGCTGCGCCACGCATCGGCCCATGACCCG
GACCTGGTCGACCTCAGCGGCTCCGGGTCACTCTGGGCGCTCGGTCACGGCAACGCGCTGATGACACAGCGCGGT
CCCCAAGACTCGATTCGCGTTTATGCGGCCATCAGCTCCCCGGACGAGCACTGGGCTTCCGCCGTCGGACTCCGG
GGCCGGACGACGAGCGAGGCCAAGACGTTTCTATTGGGTCCCGGCGGGCCATTCAGCAACTGGGCGTCACCGCTT
CAACACCTGCTGGCGACGGTCTGCGACGCCGACAGCCAGGACCACGTTGGCCGAGCCGTGGACGTCATGCCGCTG
TATGCGCTCCCAGCCGGCCATCTCTGGTCCCGGAACGGGGGCGGAGCGACGCTCATCGGCGATGCCGCCCACCTG
ATGCTTCCCTTTGCCGGCGAGGGCGTCAACCTCGCGCTTTGGGACGCCCTCGACCTCGCCCGATTGCTGGCCGAG
GTGTCTGAGGCAGCCGACGCAAAGGCTTGGCAGGCTGGACTGGAGCCGCGGCTGCGGGCCATGGAGGAGAGGATG
CAGGCCAGGGCGCAGAAGAAGTCCGAGGAGGCGAGACGCAACAAGGAGATGATGCTTGGCGACGGGGCAGCCGAC
GTAGTGGCAGCCTGGTTCAGGCGTCACCAGGGGTCGGACGGATAG
Gene >Ophio5|2813
ATGCGCGGCTTTCGGCCTCGGATCGCCATCGCGGGCGGGGGCCCCTCCGGCCTGGCCCTGTCACTGCTCCTCCGA
CGATACGGCATCGGCAGCACCGTGTACGAACTGCGGCATAAGCCCCGGCCCGAGGAGCTGGCCGAGCCGTCAGGC
ATGCTGGACTTACACGAGGAGTCGGGCTTGACGGTGATGCGTGAATGTGGCCTGTGGGAGGGCTTCCAGGCAAAG
GTGGGCGACTGCTCAGAGGCAATGCGCGTCTTACGGTCGGACGGCGTCGAGGTTCACGCCGATGACGGCCGGGGC
GAGCCGCGGCCCGAAATTCCGCGTCACGGCCTCATCCGGCTGCTGGCGGAGAAGCTCCCCGATGATGCCGTCCGG
TGGGGCAGCAAGGTAGCAGCAGTGCGACGGAGCCGGAACCCGGAGACGGATGCAGTCGAGGCCACGGTCGAGCTC
GCCGGTAGCGACTCGGCCACTTACGACCTGGTCATCGGCGCCGATGGTGCTTGGTCGCGCGTGAGAGCTCTCGTC
TCGGACACGAAGCCGGCCTACTGCGGAACCCAACTGGTGACGGCGACGCTGCGCCACGCATCGGCCCATGACCCG
GACCTGGTCGACCTCAGCGGCTCCGGGTCACTCTGGGCGCTCGGTCACGGCAACGCGCTGATGACACAGCGCGGT
CCCCAAGACTCGATTCGCGTTTATGCGGCCATCAGCTCCCCGGACGAGCACTGGGCTTCCGCCGTCGGACTCCGG
GGCCGGACGACGAGCGAGGCCAAGACGTTTCTATTGGGTCCCGGCGGGCCATTCAGCAACTGGGCGTCACCGCTT
CAACACCTGCTGGCGACGGTCTGCGACGCCGACAGCCAGGACCACGTTGGCCGAGCCGTGGACGTCATGCCGCTG
TATGCGCTCCCAGCCGGCCATCTCTGGTCCCGGAACGGGGGCGGAGCGACGCTCATCGGCGATGCCGCCCACCTG
ATGCTTCCCTTTGCCGGCGAGGGCGTCAACCTCGCGCTTTGGGACGCCCTCGACCTCGCCCGATTGCTGGCCGAG
GTGTCTGAGGCAGCCGACGCAAAGGCTTGGCAGGCTGGACTGGAGCCGCGGCTGCGGGCCATGGAGGAGAGGATG
CAGGCCAGGGCGCAGAAGAAGTCCGAGGAGGCGAGACGCAACAAGGAGATGATGCTTGGCGACGGGGCAGCCGAC
GTAGTGGCAGCCTGGTTCAGGCGTCACCAGGGGTCGGACGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail