Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2790
Gene name
Locationscaffold_224:20472..21597
Strand+
Gene length (bp)1125
Transcript length (bp)1125
Coding sequence length (bp)1122
Protein length (aa) 374

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 9.7E-33 8 284

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0016020 membrane No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Signal peptide 0.1432 0.0802 0.4689 0.678 0.1042 0.0058 0.1082 0.6723 0.3815 0.0044

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 190 212 22
3 225 247 22
4 267 289 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2224
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5622
Ophiocordyceps australis map64 (Brazil) OphauB2|3158
Ophiocordyceps camponoti-floridani Ophcf2|02293
Ophiocordyceps camponoti-rufipedis Ophun1|6333
Ophiocordyceps kimflemingae Ophio5|2790 (this protein)
Ophiocordyceps subramaniannii Hirsu2|284

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2790
MAVGRFVCVAVPLVLTVAAIIAALVATLSGVTHQSLPLFSVNASGLSFNPANLVDLANSLHTRQLPKELADKLPP
GLADKIPPELANKIPPELADKITPEVADKIPQVLANNVTAGTLGIVDVMDVSLWGFCSVARDGTRECTKAQFDWA
SHSLNESLIDSLTAAAGLSIRLPDEVRSALQAFRTISKWTEVAFVVSLVALGIELLVGIFAGCSRVASCLTWVVA
SIAAVLVGIAAGLATATATIVVGTVDTSGRNLGLDATVGKRFLAAAWIAFAFAAAAALFWLFTICCCKPEHRSRA
GFQSVNRNRESDGEKLIPGGKGYAPVGNPYSGEHESSGALPQGQPGQPYSQYPPRYPSGTARPDMAYEPYSHRV
Coding >Ophio5|2790
ATGGCTGTCGGCCGCTTCGTCTGTGTCGCCGTTCCCCTGGTCCTGACCGTGGCCGCCATCATCGCCGCGCTCGTG
GCCACACTCTCGGGCGTAACACACCAAAGCCTCCCGCTCTTCAGCGTCAACGCCTCGGGCCTGTCGTTCAATCCC
GCCAACCTGGTCGACCTCGCCAACTCGCTTCATACTCGTCAACTTCCCAAAGAGCTGGCGGATAAGTTGCCTCCG
GGGCTGGCAGACAAGATCCCCCCGGAGCTGGCAAATAAAATCCCCCCAGAGTTGGCGGACAAGATCACGCCAGAG
GTGGCGGACAAAATCCCTCAGGTGCTTGCCAACAACGTCACAGCCGGCACCCTGGGCATTGTCGATGTCATGGAC
GTGTCACTCTGGGGCTTCTGCTCCGTGGCCCGGGACGGTACCCGCGAGTGCACCAAGGCTCAGTTCGATTGGGCT
TCACACTCGCTCAACGAATCGCTGATTGACAGCCTTACGGCGGCTGCGGGCCTCTCGATCAGGCTGCCAGACGAG
GTCAGGAGCGCGCTGCAGGCCTTCCGCACCATCAGCAAGTGGACCGAGGTGGCCTTTGTTGTCTCGCTCGTCGCC
CTCGGCATCGAGCTGCTCGTGGGCATCTTTGCCGGCTGCTCGCGCGTCGCCTCGTGCCTGACCTGGGTCGTCGCC
TCCATCGCGGCTGTTTTGGTGGGCATCGCGGCCGGGCTCGCCACGGCCACGGCCACCATCGTCGTCGGCACCGTC
GATACGTCCGGCCGTAACCTGGGCCTCGACGCCACAGTCGGCAAACGCTTCCTCGCCGCCGCGTGGATCGCCTTC
GCCTTCGCCGCCGCCGCCGCCCTCTTCTGGCTCTTCACCATCTGCTGCTGCAAGCCCGAGCACCGAAGCCGCGCC
GGCTTCCAGTCGGTCAACAGGAACCGCGAATCGGACGGCGAGAAGCTGATACCCGGCGGCAAGGGCTACGCGCCC
GTCGGCAACCCCTACAGCGGCGAGCACGAGTCCTCGGGGGCGTTGCCCCAAGGCCAGCCCGGACAGCCCTACTCG
CAGTACCCGCCCCGCTACCCCAGCGGCACCGCCCGGCCGGACATGGCCTACGAGCCCTACTCCCATCGAGTG
Transcript >Ophio5|2790
ATGGCTGTCGGCCGCTTCGTCTGTGTCGCCGTTCCCCTGGTCCTGACCGTGGCCGCCATCATCGCCGCGCTCGTG
GCCACACTCTCGGGCGTAACACACCAAAGCCTCCCGCTCTTCAGCGTCAACGCCTCGGGCCTGTCGTTCAATCCC
GCCAACCTGGTCGACCTCGCCAACTCGCTTCATACTCGTCAACTTCCCAAAGAGCTGGCGGATAAGTTGCCTCCG
GGGCTGGCAGACAAGATCCCCCCGGAGCTGGCAAATAAAATCCCCCCAGAGTTGGCGGACAAGATCACGCCAGAG
GTGGCGGACAAAATCCCTCAGGTGCTTGCCAACAACGTCACAGCCGGCACCCTGGGCATTGTCGATGTCATGGAC
GTGTCACTCTGGGGCTTCTGCTCCGTGGCCCGGGACGGTACCCGCGAGTGCACCAAGGCTCAGTTCGATTGGGCT
TCACACTCGCTCAACGAATCGCTGATTGACAGCCTTACGGCGGCTGCGGGCCTCTCGATCAGGCTGCCAGACGAG
GTCAGGAGCGCGCTGCAGGCCTTCCGCACCATCAGCAAGTGGACCGAGGTGGCCTTTGTTGTCTCGCTCGTCGCC
CTCGGCATCGAGCTGCTCGTGGGCATCTTTGCCGGCTGCTCGCGCGTCGCCTCGTGCCTGACCTGGGTCGTCGCC
TCCATCGCGGCTGTTTTGGTGGGCATCGCGGCCGGGCTCGCCACGGCCACGGCCACCATCGTCGTCGGCACCGTC
GATACGTCCGGCCGTAACCTGGGCCTCGACGCCACAGTCGGCAAACGCTTCCTCGCCGCCGCGTGGATCGCCTTC
GCCTTCGCCGCCGCCGCCGCCCTCTTCTGGCTCTTCACCATCTGCTGCTGCAAGCCCGAGCACCGAAGCCGCGCC
GGCTTCCAGTCGGTCAACAGGAACCGCGAATCGGACGGCGAGAAGCTGATACCCGGCGGCAAGGGCTACGCGCCC
GTCGGCAACCCCTACAGCGGCGAGCACGAGTCCTCGGGGGCGTTGCCCCAAGGCCAGCCCGGACAGCCCTACTCG
CAGTACCCGCCCCGCTACCCCAGCGGCACCGCCCGGCCGGACATGGCCTACGAGCCCTACTCCCATCGAGTGTAG
Gene >Ophio5|2790
ATGGCTGTCGGCCGCTTCGTCTGTGTCGCCGTTCCCCTGGTCCTGACCGTGGCCGCCATCATCGCCGCGCTCGTG
GCCACACTCTCGGGCGTAACACACCAAAGCCTCCCGCTCTTCAGCGTCAACGCCTCGGGCCTGTCGTTCAATCCC
GCCAACCTGGTCGACCTCGCCAACTCGCTTCATACTCGTCAACTTCCCAAAGAGCTGGCGGATAAGTTGCCTCCG
GGGCTGGCAGACAAGATCCCCCCGGAGCTGGCAAATAAAATCCCCCCAGAGTTGGCGGACAAGATCACGCCAGAG
GTGGCGGACAAAATCCCTCAGGTGCTTGCCAACAACGTCACAGCCGGCACCCTGGGCATTGTCGATGTCATGGAC
GTGTCACTCTGGGGCTTCTGCTCCGTGGCCCGGGACGGTACCCGCGAGTGCACCAAGGCTCAGTTCGATTGGGCT
TCACACTCGCTCAACGAATCGCTGATTGACAGCCTTACGGCGGCTGCGGGCCTCTCGATCAGGCTGCCAGACGAG
GTCAGGAGCGCGCTGCAGGCCTTCCGCACCATCAGCAAGTGGACCGAGGTGGCCTTTGTTGTCTCGCTCGTCGCC
CTCGGCATCGAGCTGCTCGTGGGCATCTTTGCCGGCTGCTCGCGCGTCGCCTCGTGCCTGACCTGGGTCGTCGCC
TCCATCGCGGCTGTTTTGGTGGGCATCGCGGCCGGGCTCGCCACGGCCACGGCCACCATCGTCGTCGGCACCGTC
GATACGTCCGGCCGTAACCTGGGCCTCGACGCCACAGTCGGCAAACGCTTCCTCGCCGCCGCGTGGATCGCCTTC
GCCTTCGCCGCCGCCGCCGCCCTCTTCTGGCTCTTCACCATCTGCTGCTGCAAGCCCGAGCACCGAAGCCGCGCC
GGCTTCCAGTCGGTCAACAGGAACCGCGAATCGGACGGCGAGAAGCTGATACCCGGCGGCAAGGGCTACGCGCCC
GTCGGCAACCCCTACAGCGGCGAGCACGAGTCCTCGGGGGCGTTGCCCCAAGGCCAGCCCGGACAGCCCTACTCG
CAGTACCCGCCCCGCTACCCCAGCGGCACCGCCCGGCCGGACATGGCCTACGAGCCCTACTCCCATCGAGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail