Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2783
Gene name
Locationscaffold_224:2256..2952
Strand+
Gene length (bp)696
Transcript length (bp)696
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08510 PIG-P PIG-P 9.9E-54 85 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13904|MUG84_SCHPO Meiotically up-regulated gene 84 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug84 PE=1 SV=3 33 196 2.0E-37
sp|Q9JHG1|PIGP_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Mus musculus GN=Pigp PE=2 SV=1 83 228 4.0E-14
sp|Q5R946|PIGP_PONAB Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Pongo abelii GN=PIGP PE=2 SV=1 83 228 9.0E-14
sp|P57054|PIGP_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Homo sapiens GN=PIGP PE=1 SV=3 83 228 2.0E-13
sp|O64792|PIGP_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Arabidopsis thaliana GN=At1g61280 PE=2 SV=1 85 150 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13904|MUG84_SCHPO Meiotically up-regulated gene 84 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug84 PE=1 SV=3 33 196 2.0E-37
sp|Q9JHG1|PIGP_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Mus musculus GN=Pigp PE=2 SV=1 83 228 4.0E-14
sp|Q5R946|PIGP_PONAB Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Pongo abelii GN=PIGP PE=2 SV=1 83 228 9.0E-14
sp|P57054|PIGP_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Homo sapiens GN=PIGP PE=1 SV=3 83 228 2.0E-13
sp|O64792|PIGP_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Arabidopsis thaliana GN=At1g61280 PE=2 SV=1 85 150 2.0E-09
sp|Q04082|GPI19_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI19 PE=1 SV=1 85 176 3.0E-08
sp|Q756D4|GPI19_ASHGO Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI19 PE=3 SV=1 123 230 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 88 107 19
2 127 149 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 22.29 8.12 36.46
CcL In ants, during behavior modification 15.95 5.06 26.84
CcD In ants, recently dead 22.55 8.30 36.80

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.319004 no
SC16a CcD 0.976907 no
CcL CcD 0.304204 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2783
MSASSEEKDEYLSDNQSSDSSGHEWPARPLSQTYFAPPFYGRPPTPLPPSPSLTSLLRPSRPTTPDASDDDNMAP
VPRASPQVPTYEYYGFVLYLFSSLTFLLWLLWSYLPAPFLHGLGIYYYPNRWWALAIPAFLTMTLCYIYVALASY
NTEILTLPMASVETVVDGAGKLAVIDAKGRLRGSSKRERKCDSNGRLRWREVWNEGTDAVMDIPLAGVCEVLYGD
GREEAA
Coding >Ophio5|2783
ATGTCGGCCTCATCGGAGGAGAAAGACGAGTATCTCTCGGATAACCAGTCCTCCGACTCGTCTGGTCACGAGTGG
CCGGCTCGGCCCCTGTCGCAAACGTACTTCGCGCCGCCCTTCTACGGCCGCCCGCCGACGCCGCTGCCTCCTTCG
CCGTCGCTGACGTCGCTCCTTCGACCGTCGCGCCCGACGACGCCAGACGCCTCGGACGATGACAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACATATGAATACTACGGTTTCGTGCTGTACTTGTTCAGTAGCCTGACG
TTTCTACTATGGCTCCTCTGGAGCTATCTACCGGCGCCCTTTCTGCATGGCCTGGGTATCTACTATTATCCGAAT
CGGTGGTGGGCGCTGGCCATTCCTGCCTTTCTCACCATGACACTGTGCTACATCTATGTGGCGCTGGCTTCGTAC
AACACGGAGATTCTTACGCTGCCCATGGCCAGCGTGGAGACGGTCGTCGACGGCGCAGGGAAGCTGGCCGTCATC
GACGCCAAGGGCCGGCTACGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGGCGCCTGAGGTGGAGG
GAGGTCTGGAACGAGGGAACCGATGCCGTCATGGACATACCCTTGGCCGGAGTGTGTGAGGTCCTCTACGGAGAC
GGGCGCGAGGAAGCCGCC
Transcript >Ophio5|2783
ATGTCGGCCTCATCGGAGGAGAAAGACGAGTATCTCTCGGATAACCAGTCCTCCGACTCGTCTGGTCACGAGTGG
CCGGCTCGGCCCCTGTCGCAAACGTACTTCGCGCCGCCCTTCTACGGCCGCCCGCCGACGCCGCTGCCTCCTTCG
CCGTCGCTGACGTCGCTCCTTCGACCGTCGCGCCCGACGACGCCAGACGCCTCGGACGATGACAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACATATGAATACTACGGTTTCGTGCTGTACTTGTTCAGTAGCCTGACG
TTTCTACTATGGCTCCTCTGGAGCTATCTACCGGCGCCCTTTCTGCATGGCCTGGGTATCTACTATTATCCGAAT
CGGTGGTGGGCGCTGGCCATTCCTGCCTTTCTCACCATGACACTGTGCTACATCTATGTGGCGCTGGCTTCGTAC
AACACGGAGATTCTTACGCTGCCCATGGCCAGCGTGGAGACGGTCGTCGACGGCGCAGGGAAGCTGGCCGTCATC
GACGCCAAGGGCCGGCTACGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGGCGCCTGAGGTGGAGG
GAGGTCTGGAACGAGGGAACCGATGCCGTCATGGACATACCCTTGGCCGGAGTGTGTGAGGTCCTCTACGGAGAC
GGGCGCGAGGAAGCCGCCTGA
Gene >Ophio5|2783
ATGTCGGCCTCATCGGAGGAGAAAGACGAGTATCTCTCGGATAACCAGTCCTCCGACTCGTCTGGTCACGAGTGG
CCGGCTCGGCCCCTGTCGCAAACGTACTTCGCGCCGCCCTTCTACGGCCGCCCGCCGACGCCGCTGCCTCCTTCG
CCGTCGCTGACGTCGCTCCTTCGACCGTCGCGCCCGACGACGCCAGACGCCTCGGACGATGACAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACATATGAATACTACGGTTTCGTGCTGTACTTGTTCAGTAGCCTGACG
TTTCTACTATGGCTCCTCTGGAGCTATCTACCGGCGCCCTTTCTGCATGGCCTGGGTATCTACTATTATCCGAAT
CGGTGGTGGGCGCTGGCCATTCCTGCCTTTCTCACCATGACACTGTGCTACATCTATGTGGCGCTGGCTTCGTAC
AACACGGAGATTCTTACGCTGCCCATGGCCAGCGTGGAGACGGTCGTCGACGGCGCAGGGAAGCTGGCCGTCATC
GACGCCAAGGGCCGGCTACGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGGCGCCTGAGGTGGAGG
GAGGTCTGGAACGAGGGAACCGATGCCGTCATGGACATACCCTTGGCCGGAGTGTGTGAGGTCCTCTACGGAGAC
GGGCGCGAGGAAGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail