Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2783
Gene name
Locationscaffold_224:2256..2952
Strand+
Gene length (bp)696
Transcript length (bp)696
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08510 PIG-P PIG-P 9.9E-54 85 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13904|MUG84_SCHPO Meiotically up-regulated gene 84 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug84 PE=1 SV=3 33 196 2.0E-37
sp|Q9JHG1|PIGP_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Mus musculus GN=Pigp PE=2 SV=1 83 228 4.0E-14
sp|Q5R946|PIGP_PONAB Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Pongo abelii GN=PIGP PE=2 SV=1 83 228 9.0E-14
sp|P57054|PIGP_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Homo sapiens GN=PIGP PE=1 SV=3 83 228 2.0E-13
sp|O64792|PIGP_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Arabidopsis thaliana GN=At1g61280 PE=2 SV=1 85 150 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13904|MUG84_SCHPO Meiotically up-regulated gene 84 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug84 PE=1 SV=3 33 196 2.0E-37
sp|Q9JHG1|PIGP_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Mus musculus GN=Pigp PE=2 SV=1 83 228 4.0E-14
sp|Q5R946|PIGP_PONAB Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Pongo abelii GN=PIGP PE=2 SV=1 83 228 9.0E-14
sp|P57054|PIGP_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Homo sapiens GN=PIGP PE=1 SV=3 83 228 2.0E-13
sp|O64792|PIGP_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit P OS=Arabidopsis thaliana GN=At1g61280 PE=2 SV=1 85 150 2.0E-09
sp|Q04082|GPI19_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI19 PE=1 SV=1 85 176 3.0E-08
sp|Q756D4|GPI19_ASHGO Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI19 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI19 PE=3 SV=1 123 230 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 88 107 19
2 127 149 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2783
MSASSEEKDEYLSDNQSSDSSGHEWPARPLSQTYFAPPFYGRPPTPLPPSPSLTSLLRPSRPTTPDASDDDNMAP
VPRASPQVPTYEYYGFVLYLFSSLTFLLWLLWSYLPAPFLHGLGIYYYPNRWWALAIPAFLTMTLCYIYVALASY
NTEILTLPMASVETVVDGAGKLAVIDAKGRLRGSSKRERKCDSNGRLRWREVWNEGTDAVMDIPLAGVCEVLYGD
GREEAA
Coding >Ophio5|2783
ATGTCGGCCTCATCGGAGGAGAAAGACGAGTATCTCTCGGATAACCAGTCCTCCGACTCGTCTGGTCACGAGTGG
CCGGCTCGGCCCCTGTCGCAAACGTACTTCGCGCCGCCCTTCTACGGCCGCCCGCCGACGCCGCTGCCTCCTTCG
CCGTCGCTGACGTCGCTCCTTCGACCGTCGCGCCCGACGACGCCAGACGCCTCGGACGATGACAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACATATGAATACTACGGTTTCGTGCTGTACTTGTTCAGTAGCCTGACG
TTTCTACTATGGCTCCTCTGGAGCTATCTACCGGCGCCCTTTCTGCATGGCCTGGGTATCTACTATTATCCGAAT
CGGTGGTGGGCGCTGGCCATTCCTGCCTTTCTCACCATGACACTGTGCTACATCTATGTGGCGCTGGCTTCGTAC
AACACGGAGATTCTTACGCTGCCCATGGCCAGCGTGGAGACGGTCGTCGACGGCGCAGGGAAGCTGGCCGTCATC
GACGCCAAGGGCCGGCTACGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGGCGCCTGAGGTGGAGG
GAGGTCTGGAACGAGGGAACCGATGCCGTCATGGACATACCCTTGGCCGGAGTGTGTGAGGTCCTCTACGGAGAC
GGGCGCGAGGAAGCCGCC
Transcript >Ophio5|2783
ATGTCGGCCTCATCGGAGGAGAAAGACGAGTATCTCTCGGATAACCAGTCCTCCGACTCGTCTGGTCACGAGTGG
CCGGCTCGGCCCCTGTCGCAAACGTACTTCGCGCCGCCCTTCTACGGCCGCCCGCCGACGCCGCTGCCTCCTTCG
CCGTCGCTGACGTCGCTCCTTCGACCGTCGCGCCCGACGACGCCAGACGCCTCGGACGATGACAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACATATGAATACTACGGTTTCGTGCTGTACTTGTTCAGTAGCCTGACG
TTTCTACTATGGCTCCTCTGGAGCTATCTACCGGCGCCCTTTCTGCATGGCCTGGGTATCTACTATTATCCGAAT
CGGTGGTGGGCGCTGGCCATTCCTGCCTTTCTCACCATGACACTGTGCTACATCTATGTGGCGCTGGCTTCGTAC
AACACGGAGATTCTTACGCTGCCCATGGCCAGCGTGGAGACGGTCGTCGACGGCGCAGGGAAGCTGGCCGTCATC
GACGCCAAGGGCCGGCTACGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGGCGCCTGAGGTGGAGG
GAGGTCTGGAACGAGGGAACCGATGCCGTCATGGACATACCCTTGGCCGGAGTGTGTGAGGTCCTCTACGGAGAC
GGGCGCGAGGAAGCCGCCTGA
Gene >Ophio5|2783
ATGTCGGCCTCATCGGAGGAGAAAGACGAGTATCTCTCGGATAACCAGTCCTCCGACTCGTCTGGTCACGAGTGG
CCGGCTCGGCCCCTGTCGCAAACGTACTTCGCGCCGCCCTTCTACGGCCGCCCGCCGACGCCGCTGCCTCCTTCG
CCGTCGCTGACGTCGCTCCTTCGACCGTCGCGCCCGACGACGCCAGACGCCTCGGACGATGACAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACATATGAATACTACGGTTTCGTGCTGTACTTGTTCAGTAGCCTGACG
TTTCTACTATGGCTCCTCTGGAGCTATCTACCGGCGCCCTTTCTGCATGGCCTGGGTATCTACTATTATCCGAAT
CGGTGGTGGGCGCTGGCCATTCCTGCCTTTCTCACCATGACACTGTGCTACATCTATGTGGCGCTGGCTTCGTAC
AACACGGAGATTCTTACGCTGCCCATGGCCAGCGTGGAGACGGTCGTCGACGGCGCAGGGAAGCTGGCCGTCATC
GACGCCAAGGGCCGGCTACGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGGCGCCTGAGGTGGAGG
GAGGTCTGGAACGAGGGAACCGATGCCGTCATGGACATACCCTTGGCCGGAGTGTGTGAGGTCCTCTACGGAGAC
GGGCGCGAGGAAGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail