Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2777
Gene name
Locationscaffold_223:20327..22182
Strand-
Gene length (bp)1855
Transcript length (bp)1491
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14474 RTC4 RTC4-like domain 6.6E-32 384 494

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3585 0.8526 0.2498 0.0526 0.1116 0.0589 0.0592 0.0189 0.025 0.011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1906
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2858
Ophiocordyceps australis map64 (Brazil) OphauB2|2247
Ophiocordyceps camponoti-floridani Ophcf2|05106
Ophiocordyceps camponoti-rufipedis Ophun1|7504
Ophiocordyceps kimflemingae Ophio5|2777 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2777
MVRSTFLPTSGRLQSRLASSLTTTSACLLLFHCMSSCRLRGCRDLYAGNANFRWPYRVRYCFQPARRIHINFFEK
SQTRGQRRTQAPKILPNCVRENRLPSTTLHCPATTKMVPTTFGQRPKSGKRRREETLKTETDESIKRSDSSPSSS
KKRKQQTGSAAERHQEAFQTVQIHSQMTTTTEASTAPQLQFKLPPDKHPFDLLCSPQQTQSRITKLKSPDSPPRP
PAGLIVSSKINDGFLDDSPTKTCILRKASIKVPAEVCDLVADKGDVKTLDATVCDVTSGSEQRDSPSPVSKVSGS
DAGSVAVAAECPWCGQPVEKSVLDDFSRGKRMNVRLQTKFCRDHKIQTAKETWQAMRYPEVDWEGLVKRFAEHRS
YLLGIVDGNTSHYRRDLAAKIKSGEARSMKKEGDMNPGYYGPRGFNVMCDYLVEEFGELLKRKAVNDRVIAGRGP
AAFIQCVLVAELAVMLIRDDMDVSQEEARRIMEESKALGEMLHDEA
Coding >Ophio5|2777
ATGGTCAGGTCAACTTTTCTCCCTACGAGCGGACGACTCCAGTCACGTCTTGCTTCTTCCCTCACGACCACCTCG
GCTTGTCTGCTTCTTTTCCACTGTATGAGCAGTTGCCGCTTACGAGGCTGCCGGGATCTTTACGCTGGTAACGCC
AACTTTCGCTGGCCATATCGTGTCAGGTATTGCTTTCAACCCGCAAGGAGAATCCACATCAACTTCTTCGAAAAA
TCGCAAACACGGGGGCAACGAAGAACTCAGGCGCCAAAAATCCTCCCAAACTGCGTGCGAGAAAACCGGTTGCCA
TCAACGACCCTCCACTGTCCAGCGACGACGAAGATGGTACCGACAACTTTCGGTCAACGTCCCAAGTCCGGCAAA
CGGAGACGGGAAGAGACATTGAAGACCGAGACTGACGAGTCAATCAAGCGCTCTGATAGTTCACCGTCATCTTCG
AAGAAGAGGAAGCAGCAAACTGGCAGCGCCGCTGAACGGCACCAGGAAGCATTCCAAACCGTCCAGATTCACTCA
CAAATGACTACGACGACTGAGGCGTCTACGGCACCCCAGCTCCAATTTAAGCTTCCCCCGGATAAGCACCCTTTT
GATCTCCTGTGCAGTCCGCAGCAGACCCAAAGCCGCATTACGAAGCTAAAGTCACCCGATTCACCCCCTCGACCC
CCAGCTGGTCTGATAGTGTCATCAAAAATCAATGATGGCTTCCTGGACGATTCGCCAACCAAAACCTGCATCCTG
AGAAAAGCTTCCATCAAAGTCCCTGCCGAAGTTTGCGATCTTGTGGCTGACAAAGGCGACGTCAAAACATTAGAC
GCGACTGTTTGCGACGTGACTTCAGGCTCGGAGCAGAGGGACAGCCCTTCACCCGTGTCGAAAGTCTCGGGCAGT
GATGCGGGTTCTGTCGCGGTCGCGGCAGAGTGTCCGTGGTGCGGCCAGCCCGTCGAAAAGTCAGTGCTGGACGAC
TTCTCCAGAGGCAAGCGGATGAATGTGCGGCTACAAACAAAGTTCTGCCGCGACCACAAAATACAGACGGCCAAG
GAAACATGGCAAGCCATGAGGTATCCCGAGGTGGATTGGGAGGGCCTGGTGAAGCGATTCGCGGAGCACCGCAGC
TATCTACTCGGCATCGTTGACGGTAATACGTCGCACTACCGGAGGGATCTAGCAGCCAAGATCAAGTCGGGAGAG
GCAAGGTCGATGAAGAAGGAGGGTGACATGAATCCGGGATACTACGGTCCCCGGGGCTTCAACGTCATGTGCGAC
TACCTCGTCGAGGAGTTTGGCGAGCTGCTTAAACGTAAGGCTGTCAATGACCGCGTCATTGCTGGCCGGGGGCCG
GCTGCTTTCATCCAGTGCGTTCTGGTGGCTGAATTGGCCGTGATGCTCATTCGTGACGACATGGACGTGTCGCAG
GAAGAGGCTAGAAGAATCATGGAGGAGAGCAAGGCGCTTGGTGAGATGCTTCACGATGAGGCG
Transcript >Ophio5|2777
ATGGTCAGGTCAACTTTTCTCCCTACGAGCGGACGACTCCAGTCACGTCTTGCTTCTTCCCTCACGACCACCTCG
GCTTGTCTGCTTCTTTTCCACTGTATGAGCAGTTGCCGCTTACGAGGCTGCCGGGATCTTTACGCTGGTAACGCC
AACTTTCGCTGGCCATATCGTGTCAGGTATTGCTTTCAACCCGCAAGGAGAATCCACATCAACTTCTTCGAAAAA
TCGCAAACACGGGGGCAACGAAGAACTCAGGCGCCAAAAATCCTCCCAAACTGCGTGCGAGAAAACCGGTTGCCA
TCAACGACCCTCCACTGTCCAGCGACGACGAAGATGGTACCGACAACTTTCGGTCAACGTCCCAAGTCCGGCAAA
CGGAGACGGGAAGAGACATTGAAGACCGAGACTGACGAGTCAATCAAGCGCTCTGATAGTTCACCGTCATCTTCG
AAGAAGAGGAAGCAGCAAACTGGCAGCGCCGCTGAACGGCACCAGGAAGCATTCCAAACCGTCCAGATTCACTCA
CAAATGACTACGACGACTGAGGCGTCTACGGCACCCCAGCTCCAATTTAAGCTTCCCCCGGATAAGCACCCTTTT
GATCTCCTGTGCAGTCCGCAGCAGACCCAAAGCCGCATTACGAAGCTAAAGTCACCCGATTCACCCCCTCGACCC
CCAGCTGGTCTGATAGTGTCATCAAAAATCAATGATGGCTTCCTGGACGATTCGCCAACCAAAACCTGCATCCTG
AGAAAAGCTTCCATCAAAGTCCCTGCCGAAGTTTGCGATCTTGTGGCTGACAAAGGCGACGTCAAAACATTAGAC
GCGACTGTTTGCGACGTGACTTCAGGCTCGGAGCAGAGGGACAGCCCTTCACCCGTGTCGAAAGTCTCGGGCAGT
GATGCGGGTTCTGTCGCGGTCGCGGCAGAGTGTCCGTGGTGCGGCCAGCCCGTCGAAAAGTCAGTGCTGGACGAC
TTCTCCAGAGGCAAGCGGATGAATGTGCGGCTACAAACAAAGTTCTGCCGCGACCACAAAATACAGACGGCCAAG
GAAACATGGCAAGCCATGAGGTATCCCGAGGTGGATTGGGAGGGCCTGGTGAAGCGATTCGCGGAGCACCGCAGC
TATCTACTCGGCATCGTTGACGGTAATACGTCGCACTACCGGAGGGATCTAGCAGCCAAGATCAAGTCGGGAGAG
GCAAGGTCGATGAAGAAGGAGGGTGACATGAATCCGGGATACTACGGTCCCCGGGGCTTCAACGTCATGTGCGAC
TACCTCGTCGAGGAGTTTGGCGAGCTGCTTAAACGTAAGGCTGTCAATGACCGCGTCATTGCTGGCCGGGGGCCG
GCTGCTTTCATCCAGTGCGTTCTGGTGGCTGAATTGGCCGTGATGCTCATTCGTGACGACATGGACGTGTCGCAG
GAAGAGGCTAGAAGAATCATGGAGGAGAGCAAGGCGCTTGGTGAGATGCTTCACGATGAGGCGTGA
Gene >Ophio5|2777
ATGGTCAGGTCAACTTTTCTCCCTACGAGCGGACGACTCCAGTCACGTCTTGCTTCTTCCCTCACGACCACCTCG
GCTTGTCTGCTTCTTTTCCACTGTATGAGCAGTTGCCGCTTACGAGGCTGCCGGGATCTTTACGCTGGTAACGCC
AACTTTCGCTGGCCATATCGTGTCAGGTATTGCTTTCAACGTACGCGTCATCACGGTGGCTTCAGTGCTTTCGCC
TCGATAGTGCGTCGATAGCATTGCAATTTAAAAGATGACGAACCGAAGACTCGGCCTTAGCCGCAAGGAGAATCC
ACATCAACTTCTTCGAAAAATCGCAAACACGGGGGCAACGAAGAACTCAGGCGCCAAAAATCCTCCCAAACTGCG
TGCGAGAAAACCGGTTGCCATCAACGACCCTCCACTGTCCAGCGACGACGAAGATGGTACCGACAACGTAAGCGG
CGACGATCAGCACGAGGCATCCAATACCAAACGTGGCAGTCGACTCCGGTCCCTGTCCCGGCGTTCCGCATGTGA
CGACCGCATTCTCAGTAGCTCGGGCGATGATGGAGCAGCTGAAGCTGACATAAAACCCACCAGTTTCGGTCAACG
TCCCAAGTCCGGCAAACGGAGACGGGAAGAGACATTGAAGACCGAGACTGACGAGTCAATCAAGCGCTCTGATAG
TTCACCGTCATCTTCGAAGAAGAGGAAGCAGCAAACTGGCAGCGCCGCTGAACGGCACCAGGAAGCATGTGAGGC
TCCATCTACCGCGGGCAATCCTCATAAAACTCAGTACGGATTGGCAAAGTCCAAACCGTCCAGATTCACGTACGG
GAAGCAAAAGGGTGCGCAATCGAGAAACCAGTTGAAGAAGAGGAAAACTGCGGCTGCCAAGTCACAAATGACTAC
GACGACTGAGGCGTCTACGGCACCCCAGCTCCAATTTAAGCTTCCCCCGGATAAGCACCCTTTTGATCTCCTGTG
CAGTCCGCAGCAGACCCAAAGCCGCATTACGAAGCTAAAGTCACCCGATTCACCCCCTCGACCCCCAGCTGGTCT
GATAGTGTCATCAAAAATCAATGATGGCTTCCTGGACGATTCGCCAACCAAAACCTGCATCCTGAGAAAAGCTTC
CATCAAAGTCCCTGCCGAAGTTTGCGATCTTGTGGCTGACAAAGGCGACGTCAAAACATTAGACGCGACTGTTTG
CGACGTGACTTCAGGCTCGGAGCAGAGGGACAGCCCTTCACCCGTGTCGAAAGTCTCGGGCAGTGATGCGGGTTC
TGTCGCGGTCGCGGCAGAGTGTCCGTGGTGCGGCCAGCCCGTCGAAAAGTCAGTGCTGGACGACTTCTCCAGAGG
CAAGCGGATGAATGTGCGGCTACAAACAAAGTTCTGCCGCGACCACAAAATACAGACGGCCAAGGAAACATGGCA
AGCCATGAGGTATCCCGAGGTGGATTGGGAGGGCCTGGTGAAGCGATTCGCGGAGCACCGCAGCTATCTACTCGG
CATCGTTGACGGTAATACGTCGCACTACCGGAGGGATCTAGCAGCCAAGATCAAGTCGGGAGAGGCAAGGTCGAT
GAAGAAGGAGGGTGACATGAATCCGGGATACTACGGTCCCCGGGGCTTCAACGTCATGTGCGACTACCTCGTCGA
GGAGTTTGGCGAGCTGCTTAAACGTAAGGCTGTCAATGACCGCGTCATTGCTGGCCGGGGGCCGGCTGCTTTCAT
CCAGTGCGTTCTGGTGGCTGAATTGGCCGTGATGCTCATTCGTGACGACATGGACGTGTCGCAGGAAGAGGCTAG
AAGAATCATGGAGGAGAGCAAGGCGCTTGGTGAGATGCTTCACGATGAGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail