Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2774
Gene name
Locationscaffold_223:3240..10074
Strand-
Gene length (bp)6834
Transcript length (bp)6444
Coding sequence length (bp)6441
Protein length (aa) 2147

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 2.9E-55 1420 1674
PF13855 LRR_8 Leucine rich repeat 3.4E-08 1203 1263
PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain 8.0E-30 1741 1898
PF08509 Ad_cyc_g-alpha Adenylate cyclase G-alpha binding domain 8.6E-12 496 542

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 100 2124 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 136 2144 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 598 2112 0.0E+00
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 1169 2026 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 598 2112 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 100 2124 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 136 2144 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 598 2112 0.0E+00
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 1169 2026 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 598 2112 0.0E+00
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 1203 1981 1.0E-120
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 598 1075 7.0E-87
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 560 1077 2.0E-57
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 732 1075 2.0E-28
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 720 1075 3.0E-28
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 713 1075 3.0E-28
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 732 1075 4.0E-28
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 1741 1901 2.0E-27
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 720 1052 2.0E-27
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 722 1076 5.0E-27
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 754 1080 1.0E-26
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 713 1076 1.0E-26
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 720 1075 1.0E-26
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 713 1076 1.0E-26
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 1728 1899 2.0E-25
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 1204 1700 2.0E-25
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 778 1067 2.0E-25
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 739 1076 2.0E-25
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 720 1075 3.0E-25
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 720 1075 3.0E-25
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 720 1075 6.0E-25
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 713 1076 8.0E-25
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 1204 1700 1.0E-24
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 720 1075 2.0E-24
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 716 1076 2.0E-24
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 713 1076 2.0E-24
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 711 1076 3.0E-24
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 712 1076 4.0E-24
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 651 1075 6.0E-24
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 717 1075 6.0E-24
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 748 1075 6.0E-24
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 1204 1684 6.0E-24
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 712 1076 9.0E-24
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 790 1076 1.0E-23
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 712 1076 1.0E-23
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 713 1076 1.0E-23
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 790 1076 2.0E-23
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 790 1076 2.0E-23
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 712 1076 3.0E-23
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 716 1076 4.0E-23
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 785 1075 2.0E-22
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 720 1062 2.0E-22
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 717 1076 2.0E-22
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 706 1076 3.0E-22
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 708 1076 3.0E-22
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 708 1076 3.0E-22
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 708 1076 3.0E-22
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 790 1076 6.0E-22
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 715 1069 7.0E-22
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 714 1055 8.0E-22
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 708 1076 9.0E-22
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 732 1055 1.0E-21
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 741 1076 1.0E-21
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 762 1075 2.0E-21
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 724 1075 2.0E-21
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 720 1075 2.0E-21
sp|Q25263|CYAB_LEIDO Receptor-type adenylate cyclase B OS=Leishmania donovani GN=RAC-B PE=2 SV=1 1745 1894 4.0E-21
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 651 1075 5.0E-21
sp|Q27675|CYAA_LEIDO Receptor-type adenylate cyclase A OS=Leishmania donovani GN=RAC-A PE=2 SV=1 1745 1894 6.0E-21
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 714 1046 8.0E-21
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 808 1062 1.0E-20
sp|Q99280|CY43_TRYBB Receptor-type adenylate cyclase GRESAG 4.3 OS=Trypanosoma brucei brucei GN=GRESAG 4.3 PE=1 SV=1 1741 1894 2.0E-20
sp|P26338|CYAA_TRYEQ Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma equiperdum GN=ESAG4C PE=3 SV=1 1745 1895 2.0E-20
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 764 1071 3.0E-20
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 750 1106 3.0E-20
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 764 1076 4.0E-20
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 782 1076 5.0E-20
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 708 1055 6.0E-20
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 716 1102 7.0E-20
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 1735 1896 7.0E-20
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 739 1075 1.0E-19
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 691 1075 1.0E-19
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 714 1055 1.0E-19
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 768 1009 2.0E-19
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 725 1075 2.0E-19
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 810 1075 2.0E-19
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 778 1053 3.0E-19
sp|Q26896|CYAA_TRYCO Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma congolense PE=2 SV=1 1745 1894 3.0E-19
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 708 1055 4.0E-19
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 763 1032 4.0E-19
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 711 1032 5.0E-19
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 727 1076 5.0E-19
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 720 1074 5.0E-19
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 732 1052 5.0E-19
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 739 1052 8.0E-19
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 814 1054 1.0E-18
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 759 1074 1.0E-18
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 759 1337 1.0E-18
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 778 1052 1.0E-18
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 810 1075 1.0E-18
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 729 1078 1.0E-18
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 783 1075 2.0E-18
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 714 1053 2.0E-18
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 711 918 2.0E-18
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 687 1075 2.0E-18
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 687 1075 2.0E-18
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 687 1075 2.0E-18
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 763 1309 2.0E-18
sp|Q99279|CY41_TRYBB Receptor-type adenylate cyclase GRESAG 4.1 OS=Trypanosoma brucei brucei GN=GRESAG 4.1 PE=1 SV=1 1741 1967 2.0E-18
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 787 1075 3.0E-18
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 687 1075 4.0E-18
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 711 1031 4.0E-18
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 786 1032 4.0E-18
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 744 1075 5.0E-18
sp|Q26721|CYA4_TRYBB Receptor-type adenylate cyclase ESAG 4 OS=Trypanosoma brucei brucei GN=ESAG4 PE=3 SV=1 1745 1967 5.0E-18
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 687 1075 6.0E-18
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 812 1075 8.0E-18
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 717 1075 9.0E-18
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 783 1075 1.0E-17
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 718 1115 1.0E-17
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 711 1304 1.0E-17
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 770 1047 1.0E-17
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 813 1075 2.0E-17
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 770 1337 2.0E-17
sp|Q99396|CY42_TRYBB Receptor-type adenylate cyclase GRESAG 4.2 (Fragment) OS=Trypanosoma brucei brucei GN=GRESAG 4.2 PE=2 SV=1 1745 1896 2.0E-17
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 689 1055 3.0E-17
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 714 1059 3.0E-17
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 714 1059 3.0E-17
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 708 1055 3.0E-17
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 744 1082 3.0E-17
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 740 1057 3.0E-17
sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 718 1097 3.0E-17
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 806 1053 3.0E-17
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 644 1055 4.0E-17
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 729 1032 4.0E-17
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 684 1055 5.0E-17
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 711 1046 5.0E-17
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 744 1075 5.0E-17
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 739 1033 6.0E-17
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 715 1035 6.0E-17
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 730 1071 6.0E-17
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 729 1032 7.0E-17
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 729 1032 7.0E-17
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 729 1032 7.0E-17
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 729 1032 7.0E-17
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 715 1075 7.0E-17
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 715 1053 8.0E-17
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 710 1082 8.0E-17
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 644 1055 1.0E-16
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 812 1075 1.0E-16
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 1379 1649 1.0E-16
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 714 1075 1.0E-16
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 1371 1680 1.0E-16
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 825 1080 2.0E-16
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 714 1059 2.0E-16
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 812 1080 2.0E-16
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 753 1110 2.0E-16
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 835 1300 2.0E-16
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 778 1046 2.0E-16
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 684 1055 3.0E-16
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 720 938 3.0E-16
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 741 1071 3.0E-16
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 740 1075 4.0E-16
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 714 1059 5.0E-16
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 715 1031 5.0E-16
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 791 935 5.0E-16
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 722 1075 6.0E-16
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 1404 1685 6.0E-16
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 753 888 6.0E-16
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 1204 1680 7.0E-16
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 729 1032 8.0E-16
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 754 1314 9.0E-16
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 764 1075 9.0E-16
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 776 1075 1.0E-15
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 776 1310 1.0E-15
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 720 1082 1.0E-15
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 791 1093 1.0E-15
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 715 1054 1.0E-15
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 809 1076 2.0E-15
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 814 1075 2.0E-15
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 1404 1680 2.0E-15
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 1371 1680 2.0E-15
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 759 1069 2.0E-15
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 753 888 2.0E-15
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 777 1075 3.0E-15
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 729 1243 3.0E-15
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 835 1049 3.0E-15
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 768 1008 3.0E-15
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 805 1308 4.0E-15
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 753 888 4.0E-15
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 854 1047 4.0E-15
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 717 1079 4.0E-15
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 716 931 4.0E-15
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 768 1009 4.0E-15
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 722 915 6.0E-15
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 714 1046 7.0E-15
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 833 1076 8.0E-15
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 702 1046 8.0E-15
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 740 1075 9.0E-15
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 815 1075 1.0E-14
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 831 1072 1.0E-14
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 1400 1680 1.0E-14
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 764 1075 1.0E-14
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 715 1054 1.0E-14
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 1371 1680 1.0E-14
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 711 1074 1.0E-14
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 1400 1680 1.0E-14
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 726 1073 2.0E-14
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 727 915 2.0E-14
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 825 1075 2.0E-14
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 815 1248 2.0E-14
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 825 1075 2.0E-14
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 716 1076 3.0E-14
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 720 1076 3.0E-14
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 810 1075 3.0E-14
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 715 897 3.0E-14
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 825 1075 3.0E-14
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 710 1096 3.0E-14
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 833 1076 4.0E-14
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 815 1075 4.0E-14
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 716 955 4.0E-14
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 787 1055 5.0E-14
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 722 1056 5.0E-14
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 810 1075 6.0E-14
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 1434 1685 6.0E-14
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 1400 1680 6.0E-14
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 1434 1680 6.0E-14
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 772 1266 6.0E-14
sp|Q6UXM1|LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 720 1048 7.0E-14
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 709 897 7.0E-14
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 1400 1680 7.0E-14
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 1434 1680 8.0E-14
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 814 1030 8.0E-14
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 716 915 9.0E-14
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 1528 1641 9.0E-14
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 809 1076 1.0E-13
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 709 951 1.0E-13
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 832 1298 1.0E-13
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 709 951 1.0E-13
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 812 1076 2.0E-13
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 715 1035 2.0E-13
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 765 1083 2.0E-13
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 838 1076 2.0E-13
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 1402 1680 2.0E-13
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 815 1006 2.0E-13
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 709 929 2.0E-13
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 800 1033 2.0E-13
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 613 1075 2.0E-13
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 716 1071 3.0E-13
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 717 1009 3.0E-13
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 739 917 3.0E-13
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 813 1079 3.0E-13
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 689 1071 3.0E-13
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 701 1028 3.0E-13
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 815 960 3.0E-13
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 770 1055 4.0E-13
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 717 1076 4.0E-13
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 815 960 4.0E-13
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 759 1046 4.0E-13
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 1514 1662 5.0E-13
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 1402 1680 5.0E-13
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 809 1055 6.0E-13
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 814 1031 6.0E-13
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 739 1071 6.0E-13
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 712 942 6.0E-13
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 745 1075 6.0E-13
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 1426 1692 6.0E-13
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 778 1071 7.0E-13
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 717 942 7.0E-13
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 1434 1680 7.0E-13
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 710 896 8.0E-13
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 720 935 8.0E-13
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 1373 1680 8.0E-13
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 711 1069 9.0E-13
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 713 949 1.0E-12
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 773 1079 1.0E-12
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 1526 1691 1.0E-12
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 771 1054 1.0E-12
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 735 1079 1.0E-12
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 684 1310 1.0E-12
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 1400 1639 1.0E-12
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 790 1057 1.0E-12
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 735 1106 1.0E-12
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 717 1015 1.0E-12
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 853 1075 2.0E-12
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 853 1075 2.0E-12
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 713 1055 2.0E-12
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 815 1082 2.0E-12
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 741 1076 2.0E-12
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 791 1055 2.0E-12
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 717 1076 2.0E-12
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 836 1056 2.0E-12
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 838 1076 2.0E-12
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 1434 1639 2.0E-12
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 788 1055 2.0E-12
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 1256 1680 2.0E-12
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 843 1083 3.0E-12
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 717 1076 3.0E-12
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 709 915 3.0E-12
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 727 896 3.0E-12
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 710 875 3.0E-12
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 739 917 3.0E-12
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 768 1018 3.0E-12
sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 1421 1687 3.0E-12
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 825 1082 4.0E-12
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 717 1048 4.0E-12
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 729 1287 4.0E-12
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 764 915 4.0E-12
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 805 983 4.0E-12
sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 735 1266 4.0E-12
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 1404 1649 4.0E-12
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 772 1071 4.0E-12
sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=1 SV=1 739 1051 4.0E-12
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 856 1079 5.0E-12
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 820 1076 5.0E-12
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 838 1076 5.0E-12
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 735 1314 5.0E-12
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 758 988 5.0E-12
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 1520 1687 5.0E-12
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 772 1053 5.0E-12
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 1434 1687 5.0E-12
sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=1 SV=1 1421 1687 5.0E-12
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 714 1076 6.0E-12
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 720 918 6.0E-12
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 720 918 6.0E-12
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 814 1031 6.0E-12
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 715 1077 6.0E-12
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 1402 1668 6.0E-12
sp|P23515|OMGP_HUMAN Oligodendrocyte-myelin glycoprotein OS=Homo sapiens GN=OMG PE=1 SV=2 714 913 6.0E-12
sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 1421 1687 6.0E-12
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 1404 1693 6.0E-12
sp|Q9DE67|LUM_COTJA Lumican OS=Coturnix coturnix japonica GN=LUM PE=2 SV=1 786 1056 6.0E-12
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 833 1075 7.0E-12
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 833 1076 7.0E-12
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 810 1030 7.0E-12
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 861 1103 7.0E-12
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 832 1075 7.0E-12
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 720 917 7.0E-12
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 772 1266 7.0E-12
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 856 1079 8.0E-12
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 861 1103 8.0E-12
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 926 1082 8.0E-12
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 717 1055 8.0E-12
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 722 1071 9.0E-12
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 820 1080 9.0E-12
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 720 918 9.0E-12
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 715 1055 1.0E-11
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 853 1075 1.0E-11
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 861 1076 1.0E-11
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 720 918 1.0E-11
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 720 918 1.0E-11
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 753 1055 1.0E-11
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 815 1052 1.0E-11
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 717 896 1.0E-11
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 717 896 1.0E-11
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 775 1032 1.0E-11
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 972 1076 1.0E-11
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 1434 1639 1.0E-11
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 833 1370 1.0E-11
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 720 1051 1.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 741 897 1.0E-11
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 898 1055 1.0E-11
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 935 1076 1.0E-11
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 714 1076 2.0E-11
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 853 1075 2.0E-11
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 900 1075 2.0E-11
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 710 1064 2.0E-11
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 717 896 2.0E-11
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 861 1076 2.0E-11
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 710 875 2.0E-11
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 753 882 2.0E-11
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 898 1055 2.0E-11
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 844 1075 3.0E-11
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 642 1079 3.0E-11
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 712 891 3.0E-11
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 1400 1662 3.0E-11
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 770 1071 3.0E-11
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 715 1091 3.0E-11
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 729 1075 3.0E-11
sp|O43300|LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein 2 OS=Homo sapiens GN=LRRTM2 PE=2 SV=3 786 990 3.0E-11
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 1434 1639 3.0E-11
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 1202 1440 3.0E-11
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 706 900 4.0E-11
sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 717 1071 4.0E-11
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 848 1311 4.0E-11
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 720 890 4.0E-11
sp|Q5JKN1|P2C05_ORYSJ Probable protein phosphatase 2C 5 OS=Oryza sativa subsp. japonica GN=Os01g0552300 PE=2 SV=1 1437 1687 4.0E-11
sp|Q63912|OMGP_MOUSE Oligodendrocyte-myelin glycoprotein OS=Mus musculus GN=Omg PE=1 SV=1 714 913 4.0E-11
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 719 1075 5.0E-11
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 717 1015 5.0E-11
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 1404 1639 5.0E-11
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 717 915 5.0E-11
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 717 1055 6.0E-11
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 710 1071 6.0E-11
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 814 1075 7.0E-11
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 765 1051 7.0E-11
sp|Q9WVR7|PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus GN=Ppm1f PE=2 SV=1 1522 1684 7.0E-11
sp|E9Q7T7|CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus GN=Chadl PE=1 SV=1 719 975 7.0E-11
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 1434 1668 7.0E-11
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 1374 1673 7.0E-11
sp|O22938|PXC3_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 OS=Arabidopsis thaliana GN=PXC3 PE=2 SV=1 735 1086 7.0E-11
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 853 1075 8.0E-11
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 738 1072 8.0E-11
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 1430 1639 8.0E-11
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 720 915 8.0E-11
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 720 1105 8.0E-11
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 733 1004 8.0E-11
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 736 1049 8.0E-11
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 775 1032 8.0E-11
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 765 1051 8.0E-11
sp|Q8BGA3|LRRT2_MOUSE Leucine-rich repeat transmembrane neuronal protein 2 OS=Mus musculus GN=Lrrtm2 PE=2 SV=1 786 1018 9.0E-11
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 1427 1681 9.0E-11
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 814 1010 9.0E-11
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 741 918 1.0E-10
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 729 1076 1.0E-10
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 831 1075 1.0E-10
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 729 1314 1.0E-10
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 710 1023 1.0E-10
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 786 1076 1.0E-10
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 710 1064 1.0E-10
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 744 1069 1.0E-10
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 842 1035 1.0E-10
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 761 915 1.0E-10
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 777 1060 1.0E-10
sp|A0CUB5|PP2C5_PARTE Probable protein phosphatase 2C 5 OS=Paramecium tetraurelia GN=GSPATT00010582001 PE=3 SV=1 1434 1672 1.0E-10
sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 1435 1690 1.0E-10
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 791 1116 1.0E-10
sp|O64583|P2C28_ARATH Probable protein phosphatase 2C 28 OS=Arabidopsis thaliana GN=At2g34740 PE=2 SV=2 1434 1681 1.0E-10
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 709 940 1.0E-10
sp|A4IIW9|LIGO1_XENTR Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Xenopus tropicalis GN=lingo1 PE=2 SV=1 790 1051 1.0E-10
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 720 915 1.0E-10
sp|Q4WQG5|CCR4_ASPFU Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccr4 PE=3 SV=1 979 1076 1.0E-10
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 702 1046 1.0E-10
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 711 982 2.0E-10
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 770 1080 2.0E-10
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 720 935 2.0E-10
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 716 1071 2.0E-10
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 944 1076 2.0E-10
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 702 1075 2.0E-10
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 735 1049 2.0E-10
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 719 1075 2.0E-10
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 715 1081 2.0E-10
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 714 951 2.0E-10
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 842 1035 2.0E-10
sp|D4AC13|LGR5_RAT Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Rattus norvegicus GN=Lgr5 PE=3 SV=1 706 1051 2.0E-10
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 694 958 2.0E-10
sp|D4A7P2|LRRT2_RAT Leucine-rich repeat transmembrane neuronal protein 2 OS=Rattus norvegicus GN=Lrrtm2 PE=1 SV=1 786 1018 2.0E-10
sp|Q50L44|LIGO1_CHICK Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Gallus gallus GN=LINGO1 PE=2 SV=1 791 1051 2.0E-10
sp|Q32KX5|LRC28_BOVIN Leucine-rich repeat-containing protein 28 OS=Bos taurus GN=LRRC28 PE=2 SV=1 709 889 2.0E-10
sp|Q9Z1P4|LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus GN=Lgr5 PE=2 SV=2 706 1051 2.0E-10
sp|A1CW67|CCR4_NEOFI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ccr4 PE=3 SV=1 979 1076 2.0E-10
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 709 889 2.0E-10
sp|Q66HD6|LRC18_RAT Leucine-rich repeat-containing protein 18 OS=Rattus norvegicus GN=Lrrc18 PE=2 SV=1 720 890 2.0E-10
sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=1 SV=1 720 1051 2.0E-10
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 741 1077 2.0E-10
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 710 1046 3.0E-10
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 733 1072 3.0E-10
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 717 889 3.0E-10
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 729 1077 3.0E-10
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 711 1076 3.0E-10
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 833 1052 3.0E-10
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 1402 1680 3.0E-10
sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 OS=Oryza sativa subsp. japonica GN=Os06g0179700 PE=2 SV=1 1410 1681 3.0E-10
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 1434 1662 3.0E-10
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 847 1076 4.0E-10
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 717 1081 4.0E-10
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 804 966 4.0E-10
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 735 1069 4.0E-10
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 759 935 4.0E-10
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 712 919 4.0E-10
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 788 1051 4.0E-10
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 782 1071 4.0E-10
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 754 938 4.0E-10
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 1404 1656 4.0E-10
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 1404 1649 4.0E-10
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 710 1089 4.0E-10
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 1412 1687 4.0E-10
sp|Q940E8|FEA2_MAIZE Leucine-rich repeat receptor-like protein FASCIATED EAR2 OS=Zea mays GN=FEA2 PE=1 SV=1 703 1049 4.0E-10
sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 764 938 4.0E-10
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 720 866 4.0E-10
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 716 929 5.0E-10
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 750 1065 5.0E-10
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 717 1049 5.0E-10
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 1378 1649 5.0E-10
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 1404 1650 5.0E-10
sp|P35814|PPM1A_RABIT Protein phosphatase 1A OS=Oryctolagus cuniculus GN=PPM1A PE=2 SV=1 1402 1681 5.0E-10
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 753 980 5.0E-10
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 834 1071 6.0E-10
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 722 1056 6.0E-10
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 841 1076 7.0E-10
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 717 889 7.0E-10
sp|P20650|PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus GN=Ppm1a PE=1 SV=1 1402 1681 7.0E-10
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 733 1074 7.0E-10
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 741 1069 7.0E-10
sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=1 SV=1 1522 1680 7.0E-10
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 722 938 8.0E-10
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 763 930 8.0E-10
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 717 1076 8.0E-10
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 711 1071 8.0E-10
sp|A1CIJ6|CCR4_ASPCL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccr4 PE=3 SV=1 979 1076 8.0E-10
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 861 1075 8.0E-10
sp|P49443|PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus GN=Ppm1a PE=1 SV=1 1402 1716 8.0E-10
sp|Q0J2R1|P2C67_ORYSJ Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica GN=Os09g0314400 PE=2 SV=1 1521 1665 8.0E-10
sp|Q9LNP9|P2C07_ARATH Protein phosphatase 2C 7 OS=Arabidopsis thaliana GN=HAB2 PE=1 SV=2 1431 1692 9.0E-10
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 717 889 1.0E-09
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 729 915 1.0E-09
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 791 1018 1.0E-09
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 720 1051 1.0E-09
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 749 1071 1.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 737 1069 1.0E-09
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 814 1076 1.0E-09
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 709 1069 1.0E-09
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 717 900 1.0E-09
sp|Q9DBY4|TRIL_MOUSE TLR4 interactor with leucine rich repeats OS=Mus musculus GN=Tril PE=2 SV=1 701 974 1.0E-09
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 1523 1636 1.0E-09
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 825 1006 1.0E-09
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 1527 1647 1.0E-09
sp|P35813|PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens GN=PPM1A PE=1 SV=1 1402 1681 1.0E-09
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 853 1080 2.0E-09
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 853 1080 2.0E-09
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 853 1080 2.0E-09
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 722 1071 2.0E-09
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 802 1075 2.0E-09
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 800 992 2.0E-09
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 741 1071 2.0E-09
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 650 919 2.0E-09
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 710 1052 2.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 720 1078 2.0E-09
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 738 918 2.0E-09
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 717 889 2.0E-09
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 706 1051 2.0E-09
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 731 940 2.0E-09
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 710 924 2.0E-09
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 768 1053 2.0E-09
sp|Q2UUI3|CCR4_ASPOR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ccr4 PE=3 SV=1 972 1076 2.0E-09
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 1382 1680 2.0E-09
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 722 1071 2.0E-09
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 712 940 2.0E-09
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 712 1031 2.0E-09
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1374 1668 2.0E-09
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 898 1055 2.0E-09
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 725 1054 3.0E-09
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 717 899 3.0E-09
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 825 1314 3.0E-09
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 825 1053 3.0E-09
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 758 1071 3.0E-09
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 711 1046 3.0E-09
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 730 1054 3.0E-09
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 718 1075 3.0E-09
sp|Q9NT99|LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens GN=LRRC4B PE=2 SV=3 704 971 3.0E-09
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 815 996 3.0E-09
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 744 1075 3.0E-09
sp|O62829|PPM1A_BOVIN Protein phosphatase 1A OS=Bos taurus GN=PPM1A PE=2 SV=1 1402 1681 3.0E-09
sp|Q149C3|LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus GN=Lingo4 PE=2 SV=2 790 1077 3.0E-09
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 979 1076 3.0E-09
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 853 1080 4.0E-09
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 868 1076 4.0E-09
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 814 1075 4.0E-09
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 759 935 4.0E-09
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 809 1022 4.0E-09
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 711 1105 4.0E-09
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 711 1076 4.0E-09
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 703 1078 4.0E-09
sp|Q496Z2|TRIL_RAT TLR4 interactor with leucine rich repeats OS=Rattus norvegicus GN=Tril PE=1 SV=1 701 974 4.0E-09
sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 744 1048 4.0E-09
sp|O75325|LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens GN=LRRN2 PE=2 SV=2 782 1048 4.0E-09
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 1404 1650 4.0E-09
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 709 916 5.0E-09
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 717 930 5.0E-09
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 717 1078 5.0E-09
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 759 935 5.0E-09
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 712 892 5.0E-09
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 809 935 5.0E-09
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 914 1074 5.0E-09
sp|O94294|SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sog2 PE=1 SV=1 791 916 5.0E-09
sp|P0CC10|LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus GN=Lrrc4b PE=1 SV=1 710 971 5.0E-09
sp|P0C192|LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus GN=Lrrc4b PE=1 SV=1 710 971 5.0E-09
sp|O93233|PLIB_GLOBS Phospholipase A2 inhibitor OS=Gloydius brevicaudus siniticus PE=1 SV=1 769 1009 5.0E-09
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 853 1080 6.0E-09
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 820 1080 6.0E-09
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 933 1075 6.0E-09
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 894 1083 6.0E-09
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 783 1264 6.0E-09
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 848 1053 6.0E-09
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 715 913 6.0E-09
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 702 1048 6.0E-09
sp|Q6ZNQ3|LRC69_HUMAN Leucine-rich repeat-containing protein 69 OS=Homo sapiens GN=LRRC69 PE=2 SV=2 763 987 6.0E-09
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 1514 1649 6.0E-09
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 861 1075 6.0E-09
sp|Q6UY18|LIGO4_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 OS=Homo sapiens GN=LINGO4 PE=2 SV=1 790 1077 6.0E-09
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 944 1082 7.0E-09
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 812 1071 8.0E-09
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 883 1075 8.0E-09
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 729 1039 8.0E-09
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 720 921 8.0E-09
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 791 1055 8.0E-09
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 762 1055 8.0E-09
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 879 1055 8.0E-09
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 711 916 8.0E-09
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 715 890 9.0E-09
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 951 1075 9.0E-09
sp|E9Q7T7|CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus GN=Chadl PE=1 SV=1 788 1015 9.0E-09
sp|O22938|PXC3_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 OS=Arabidopsis thaliana GN=PXC3 PE=2 SV=1 716 1081 9.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 689 942 9.0E-09
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 702 1064 9.0E-09
sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=2 SV=1 854 1071 9.0E-09
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 715 1049 9.0E-09
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 853 1080 1.0E-08
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 853 1076 1.0E-08
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 706 897 1.0E-08
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 861 1077 1.0E-08
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 933 1075 1.0E-08
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 836 1056 1.0E-08
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 791 1079 1.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 969 1075 1.0E-08
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 791 975 1.0E-08
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 732 1074 1.0E-08
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 809 1022 1.0E-08
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 717 900 1.0E-08
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 717 1055 1.0E-08
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 1436 1687 1.0E-08
sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 766 916 1.0E-08
sp|P51884|LUM_HUMAN Lumican OS=Homo sapiens GN=LUM PE=1 SV=2 788 1032 1.0E-08
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 726 1094 1.0E-08
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 914 1071 1.0E-08
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 717 900 1.0E-08
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 770 939 1.0E-08
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 718 1051 1.0E-08
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 853 1080 2.0E-08
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 717 891 2.0E-08
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 893 1079 2.0E-08
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 713 892 2.0E-08
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 871 1079 2.0E-08
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 764 926 2.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 895 1097 2.0E-08
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 947 1083 2.0E-08
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 716 1079 2.0E-08
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 717 1288 2.0E-08
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 758 1051 2.0E-08
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 774 1049 2.0E-08
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 874 1080 2.0E-08
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 712 892 2.0E-08
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 717 1030 2.0E-08
sp|Q06828|FMOD_HUMAN Fibromodulin OS=Homo sapiens GN=FMOD PE=1 SV=2 755 1050 2.0E-08
sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=2 SV=1 711 1026 2.0E-08
sp|Q9SSD1|TMM_ARATH Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=1 SV=1 778 952 2.0E-08
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 893 1055 2.0E-08
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 861 1071 2.0E-08
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 893 1055 2.0E-08
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 861 1071 2.0E-08
sp|Q6NWG1|LRC59_DANRE Leucine-rich repeat-containing protein 59 OS=Danio rerio GN=lrrc59 PE=2 SV=1 814 915 2.0E-08
sp|Q5Z9N5|FON1_ORYSJ Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 OS=Oryza sativa subsp. japonica GN=FON1 PE=1 SV=1 815 1082 2.0E-08
sp|Q9Z1S7|OMD_RAT Osteomodulin OS=Rattus norvegicus GN=Omd PE=2 SV=1 695 962 2.0E-08
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 969 1075 3.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 846 1072 3.0E-08
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 895 1052 3.0E-08
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 717 983 3.0E-08
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 838 1311 3.0E-08
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 847 1075 3.0E-08
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 809 960 3.0E-08
sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 802 1069 3.0E-08
sp|A6NIK2|LR10B_HUMAN Leucine-rich repeat-containing protein 10B OS=Homo sapiens GN=LRRC10B PE=4 SV=2 796 939 3.0E-08
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 992 1076 3.0E-08
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 1421 1682 3.0E-08
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 944 1075 3.0E-08
sp|A6H694|LRC63_MOUSE Leucine-rich repeat-containing protein 63 OS=Mus musculus GN=Lrrc63 PE=2 SV=1 837 979 3.0E-08
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 770 939 3.0E-08
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 760 908 4.0E-08
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 801 951 4.0E-08
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 710 1025 4.0E-08
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 805 1009 4.0E-08
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 968 1092 4.0E-08
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 736 972 4.0E-08
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 710 1054 4.0E-08
sp|Q96L50|LLR1_HUMAN Leucine-rich repeat protein 1 OS=Homo sapiens GN=LRR1 PE=1 SV=2 763 910 4.0E-08
sp|Q4PSE6|LRX7_ARATH Leucine-rich repeat extensin-like protein 7 OS=Arabidopsis thaliana GN=LRX7 PE=2 SV=1 869 1075 4.0E-08
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 861 1071 4.0E-08
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 711 918 5.0E-08
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 772 1076 5.0E-08
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 720 916 5.0E-08
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 717 892 5.0E-08
sp|Q68CR7|LRC66_HUMAN Leucine-rich repeat-containing protein 66 OS=Homo sapiens GN=LRRC66 PE=2 SV=1 693 935 5.0E-08
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 1526 1651 5.0E-08
sp|O08742|GPV_MOUSE Platelet glycoprotein V OS=Mus musculus GN=Gp5 PE=1 SV=1 703 1009 5.0E-08
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 740 884 5.0E-08
sp|C0LGK9|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1 800 1053 5.0E-08
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 710 891 6.0E-08
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 893 1055 6.0E-08
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 854 1071 6.0E-08
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 725 1085 6.0E-08
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 741 1069 6.0E-08
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 772 1069 6.0E-08
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 740 1053 6.0E-08
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 1526 1651 6.0E-08
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 717 1030 6.0E-08
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 861 1071 6.0E-08
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 1526 1651 6.0E-08
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 1526 1651 6.0E-08
sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana GN=At2g25620 PE=2 SV=1 1525 1682 6.0E-08
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 845 1071 7.0E-08
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 710 891 7.0E-08
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 778 951 7.0E-08
sp|A5PJZ2|PPM1L_BOVIN Protein phosphatase 1L OS=Bos taurus GN=PPM1L PE=2 SV=1 1434 1637 7.0E-08
sp|Q5SGD2|PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens GN=PPM1L PE=1 SV=1 1434 1637 7.0E-08
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 873 1055 8.0E-08
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 759 1080 8.0E-08
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 733 1037 8.0E-08
sp|Q8BHN0|PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus GN=Ppm1l PE=1 SV=1 1434 1637 8.0E-08
sp|P70193|LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus GN=Lrig1 PE=2 SV=2 720 1025 8.0E-08
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 1526 1649 8.0E-08
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 808 1338 9.0E-08
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 903 1075 9.0E-08
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 957 1075 9.0E-08
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 995 1075 9.0E-08
sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 691 1076 9.0E-08
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 861 1052 9.0E-08
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 1526 1651 9.0E-08
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 906 1075 1.0E-07
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 715 1079 1.0E-07
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 674 1002 1.0E-07
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 836 1082 1.0E-07
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 720 1029 1.0E-07
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 822 989 1.0E-07
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 968 1076 1.0E-07
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 716 918 1.0E-07
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 778 1071 1.0E-07
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 815 1052 1.0E-07
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 754 986 1.0E-07
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 754 892 1.0E-07
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 888 1076 1.0E-07
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 1412 1701 1.0E-07
sp|P51886|LUM_RAT Lumican OS=Rattus norvegicus GN=Lum PE=1 SV=1 788 1032 1.0E-07
sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 781 1071 1.0E-07
sp|B0BLW3|LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis GN=lgr4 PE=1 SV=1 709 1046 1.0E-07
sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1 813 1066 1.0E-07
sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 854 1071 1.0E-07
sp|P51885|LUM_MOUSE Lumican OS=Mus musculus GN=Lum PE=1 SV=2 788 1032 1.0E-07
sp|Q6EMK4|VASN_HUMAN Vasorin OS=Homo sapiens GN=VASN PE=1 SV=1 717 935 1.0E-07
sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 859 1075 1.0E-07
sp|Q3ZBN5|ASPN_BOVIN Asporin OS=Bos taurus GN=ASPN PE=2 SV=1 791 1051 1.0E-07
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 685 890 2.0E-07
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 853 1080 2.0E-07
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 933 1075 2.0E-07
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 723 929 2.0E-07
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 969 1075 2.0E-07
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 710 891 2.0E-07
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 706 1046 2.0E-07
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 951 1075 2.0E-07
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 948 1075 2.0E-07
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 744 1076 2.0E-07
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 770 954 2.0E-07
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 957 1075 2.0E-07
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 947 1075 2.0E-07
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 809 935 2.0E-07
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 736 941 2.0E-07
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 789 1078 2.0E-07
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 801 951 2.0E-07
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 874 1075 2.0E-07
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 718 1075 2.0E-07
sp|Q7Z2Q7|LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens GN=LRRC70 PE=2 SV=1 744 956 2.0E-07
sp|Q9LNF4|P2C13_ARATH Probable protein phosphatase 2C 13 OS=Arabidopsis thaliana GN=At1g48040 PE=2 SV=2 1412 1640 2.0E-07
sp|Q3UY51|LRC55_MOUSE Leucine-rich repeat-containing protein 55 OS=Mus musculus GN=Lrrc55 PE=2 SV=1 791 930 2.0E-07
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 855 1053 2.0E-07
sp|Q6P3Y9|PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus GN=Podnl1 PE=2 SV=2 719 1055 2.0E-07
sp|P49598|P2C37_ARATH Protein phosphatase 2C 37 OS=Arabidopsis thaliana GN=PP2CA PE=1 SV=1 1404 1649 2.0E-07
sp|Q9IB75|PGS1_XENLA Biglycan OS=Xenopus laevis GN=bgn PE=2 SV=1 764 1051 2.0E-07
sp|Q4KLL3|LRC55_RAT Leucine-rich repeat-containing protein 55 OS=Rattus norvegicus GN=Lrrc55 PE=2 SV=2 791 930 2.0E-07
sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 750 1071 2.0E-07
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 763 1095 3.0E-07
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 715 876 3.0E-07
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 893 1055 3.0E-07
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 715 876 3.0E-07
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 893 1055 3.0E-07
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 755 957 3.0E-07
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 893 1055 3.0E-07
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 774 1075 3.0E-07
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 785 918 3.0E-07
sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 711 1069 3.0E-07
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 871 1069 3.0E-07
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 806 1052 3.0E-07
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 893 1055 3.0E-07
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 875 1055 3.0E-07
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 790 1029 3.0E-07
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 777 1069 3.0E-07
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 1514 1680 3.0E-07
sp|Q5E9X4|LRC59_BOVIN Leucine-rich repeat-containing protein 59 OS=Bos taurus GN=LRRC59 PE=2 SV=1 838 961 3.0E-07
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 796 1276 3.0E-07
sp|Q8K0B3|LRC66_MOUSE Leucine-rich repeat-containing protein 66 OS=Mus musculus GN=Lrrc66 PE=1 SV=1 792 929 3.0E-07
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 965 1087 3.0E-07
sp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2 732 1074 3.0E-07
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 715 876 4.0E-07
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 755 957 4.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 804 959 4.0E-07
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 700 889 4.0E-07
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 852 1035 4.0E-07
sp|Q6PEZ8|PONL1_HUMAN Podocan-like protein 1 OS=Homo sapiens GN=PODNL1 PE=2 SV=2 761 1055 4.0E-07
sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=2 SV=1 713 1077 4.0E-07
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 1420 1679 4.0E-07
sp|P13605|FMOD_BOVIN Fibromodulin OS=Bos taurus GN=FMOD PE=1 SV=2 755 1050 4.0E-07
sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 788 1064 4.0E-07
sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=2 SV=2 778 958 4.0E-07
sp|Q96AG4|LRC59_HUMAN Leucine-rich repeat-containing protein 59 OS=Homo sapiens GN=LRRC59 PE=1 SV=1 838 918 4.0E-07
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 831 1050 5.0E-07
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 894 1055 5.0E-07
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 716 1054 5.0E-07
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 765 918 5.0E-07
sp|Q6ZNQ3|LRC69_HUMAN Leucine-rich repeat-containing protein 69 OS=Homo sapiens GN=LRRC69 PE=2 SV=2 815 1052 5.0E-07
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 765 918 5.0E-07
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 740 884 5.0E-07
sp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2 717 915 5.0E-07
sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 699 1001 5.0E-07
sp|P50608|FMOD_MOUSE Fibromodulin OS=Mus musculus GN=Fmod PE=2 SV=1 786 1050 5.0E-07
sp|Q9LT96|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1 812 1073 5.0E-07
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 869 1314 6.0E-07
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 951 1075 6.0E-07
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 968 1075 6.0E-07
sp|Q0P5X1|LRIQ1_MOUSE Leucine-rich repeat and IQ domain-containing protein 1 OS=Mus musculus GN=Lrriq1 PE=2 SV=2 861 1067 6.0E-07
sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=2 SV=1 856 1071 6.0E-07
sp|Q6NX28|LRC59_XENTR Leucine-rich repeat-containing protein 59 OS=Xenopus tropicalis GN=lrrc59 PE=2 SV=1 837 915 6.0E-07
sp|O80809|CLV2_ARATH Leucine-rich repeat receptor-like protein CLAVATA2 OS=Arabidopsis thaliana GN=CLV2 PE=1 SV=1 719 1071 6.0E-07
sp|Q9GKN8|PRELP_BOVIN Prolargin OS=Bos taurus GN=PRELP PE=2 SV=1 776 1028 6.0E-07
sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 759 892 6.0E-07
sp|Q6NUI6|CHADL_HUMAN Chondroadherin-like protein OS=Homo sapiens GN=CHADL PE=1 SV=2 719 1030 6.0E-07
sp|P50609|FMOD_RAT Fibromodulin OS=Rattus norvegicus GN=Fmod PE=2 SV=1 786 1050 7.0E-07
sp|Q922Q8|LRC59_MOUSE Leucine-rich repeat-containing protein 59 OS=Mus musculus GN=Lrrc59 PE=1 SV=1 838 918 7.0E-07
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 857 1056 8.0E-07
sp|Q7Z2Q7|LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens GN=LRRC70 PE=2 SV=1 790 1083 8.0E-07
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 851 1077 8.0E-07
sp|Q5RJR8|LRC59_RAT Leucine-rich repeat-containing protein 59 OS=Rattus norvegicus GN=Lrrc59 PE=1 SV=1 838 918 8.0E-07
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 943 1055 9.0E-07
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 718 1006 9.0E-07
sp|P35815|PPM1B_RAT Protein phosphatase 1B OS=Rattus norvegicus GN=Ppm1b PE=2 SV=1 1527 1714 9.0E-07
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 685 890 1.0E-06
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 730 878 1.0E-06
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 735 893 1.0E-06
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 782 1078 1.0E-06
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 948 1075 1.0E-06
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 861 1079 1.0E-06
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 992 1076 1.0E-06
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 905 1076 1.0E-06
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 944 1055 1.0E-06
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 711 1069 1.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 893 1076 1.0E-06
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 808 918 1.0E-06
sp|Q3URE9|LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus GN=Lingo2 PE=2 SV=1 791 1127 1.0E-06
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 710 1054 1.0E-06
sp|Q6UXK2|ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens GN=ISLR2 PE=2 SV=1 773 913 1.0E-06
sp|O77742|OMD_BOVIN Osteomodulin OS=Bos taurus GN=OMD PE=1 SV=1 713 934 1.0E-06
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 837 913 1.0E-06
sp|Q5FW85|ECM2_MOUSE Extracellular matrix protein 2 OS=Mus musculus GN=Ecm2 PE=1 SV=1 700 1037 1.0E-06
sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 778 1034 1.0E-06
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 1528 1693 1.0E-06
sp|Q8SU52|CCR4_ENCCU Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCR4 PE=3 SV=1 784 891 1.0E-06
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 716 890 2.0E-06
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 716 895 2.0E-06
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 711 1049 2.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 943 1075 2.0E-06
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 808 959 2.0E-06
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 941 1055 2.0E-06
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 886 1055 2.0E-06
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 837 1310 2.0E-06
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 717 1070 2.0E-06
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 771 1071 2.0E-06
sp|O93233|PLIB_GLOBS Phospholipase A2 inhibitor OS=Gloydius brevicaudus siniticus PE=1 SV=1 791 975 2.0E-06
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 765 957 2.0E-06
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 954 1076 2.0E-06
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 711 938 2.0E-06
sp|P36993|PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE=1 SV=1 1527 1684 2.0E-06
sp|Q9Z2H4|LGR4_RAT Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Rattus norvegicus GN=Lgr4 PE=2 SV=2 710 1054 2.0E-06
sp|Q9Z2H4|LGR4_RAT Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Rattus norvegicus GN=Lgr4 PE=2 SV=2 815 1075 2.0E-06
sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 730 899 2.0E-06
sp|P28675|PGS2_CHICK Decorin OS=Gallus gallus GN=DCN PE=1 SV=1 764 1028 2.0E-06
sp|P22194|SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds22 PE=1 SV=2 712 987 2.0E-06
sp|Q54Q39|PP1R7_DICDI Protein phosphatase 1 regulatory subunit pprA OS=Dictyostelium discoideum GN=pprA PE=3 SV=1 788 1000 2.0E-06
sp|Q9D5S7|LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus GN=Lrguk PE=1 SV=1 783 974 2.0E-06
sp|Q7L985|LIGO2_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Homo sapiens GN=LINGO2 PE=2 SV=1 791 1084 2.0E-06
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 758 892 2.0E-06
sp|A4IHG1|LRC58_XENTR Leucine-rich repeat-containing protein 58 OS=Xenopus tropicalis GN=lrrc58 PE=2 SV=1 736 972 2.0E-06
sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 813 1072 2.0E-06
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 969 1076 3.0E-06
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 947 1315 3.0E-06
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 777 967 3.0E-06
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 710 906 3.0E-06
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 770 945 3.0E-06
sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=1 SV=1 740 918 3.0E-06
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 688 916 3.0E-06
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 893 1076 3.0E-06
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 898 1075 3.0E-06
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 717 1046 3.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 732 918 3.0E-06
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 765 918 3.0E-06
sp|A6H694|LRC63_MOUSE Leucine-rich repeat-containing protein 63 OS=Mus musculus GN=Lrrc63 PE=2 SV=1 969 1075 3.0E-06
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 965 1087 3.0E-06
sp|Q08817|SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOG2 PE=1 SV=1 970 1227 3.0E-06
sp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=2 SV=1 804 1068 3.0E-06
sp|C0LGK4|Y2165_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g16250 OS=Arabidopsis thaliana GN=At2g16250 PE=2 SV=1 765 940 3.0E-06
sp|Q3T0W4|PP1R7_BOVIN Protein phosphatase 1 regulatory subunit 7 OS=Bos taurus GN=PPP1R7 PE=1 SV=1 899 1028 3.0E-06
sp|Q6ZSA7|LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens GN=LRRC55 PE=1 SV=2 815 930 3.0E-06
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 784 1056 4.0E-06
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 753 1044 4.0E-06
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 717 1054 4.0E-06
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 711 1071 4.0E-06
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 695 883 4.0E-06
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 717 1054 4.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 819 981 4.0E-06
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 717 1110 4.0E-06
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 765 918 4.0E-06
sp|Q9DBY4|TRIL_MOUSE TLR4 interactor with leucine rich repeats OS=Mus musculus GN=Tril PE=2 SV=1 762 1074 4.0E-06
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 872 1059 4.0E-06
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 765 918 4.0E-06
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 717 1046 4.0E-06
sp|Q7Z2Q7|LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens GN=LRRC70 PE=2 SV=1 779 1023 4.0E-06
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 979 1071 4.0E-06
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 715 957 4.0E-06
sp|P35409|GLHR_ANTEL Probable glycoprotein hormone G-protein coupled receptor OS=Anthopleura elegantissima PE=2 SV=1 740 923 4.0E-06
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 768 912 5.0E-06
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 765 1049 5.0E-06
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 784 944 5.0E-06
sp|Q9TTE2|PGS2_SHEEP Decorin OS=Ovis aries GN=DCN PE=2 SV=1 764 1028 5.0E-06
sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcription complex subunit 6-like OS=Danio rerio GN=cnot6l PE=2 SV=1 783 895 5.0E-06
sp|Q9DE68|PGS2_COTJA Decorin OS=Coturnix coturnix japonica GN=DCN PE=2 SV=1 764 1028 5.0E-06
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 815 1075 5.0E-06
sp|P21793|PGS2_BOVIN Decorin OS=Bos taurus GN=DCN PE=1 SV=2 764 1028 5.0E-06
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 710 866 6.0E-06
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 714 1054 6.0E-06
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 711 891 6.0E-06
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 757 937 6.0E-06
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 991 1075 6.0E-06
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 968 1076 6.0E-06
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 815 1052 6.0E-06
sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 717 998 6.0E-06
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 895 1048 6.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 380 435 6.0E-06
sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 856 1028 6.0E-06
sp|O94813|SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens GN=SLIT2 PE=1 SV=1 754 849 6.0E-06
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 829 1002 7.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 720 875 7.0E-06
sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 856 1078 7.0E-06
sp|Q6PJG9|LRFN4_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens GN=LRFN4 PE=1 SV=1 813 1005 7.0E-06
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 781 1079 8.0E-06
sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 825 1065 8.0E-06
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 710 1008 8.0E-06
sp|Q6R5N8|TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus GN=Tlr13 PE=1 SV=1 771 1088 8.0E-06
sp|Q810C0|SLIK2_MOUSE SLIT and NTRK-like protein 2 OS=Mus musculus GN=Slitrk2 PE=1 SV=1 858 1285 8.0E-06
sp|Q9R1B9|SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus GN=Slit2 PE=2 SV=2 763 849 8.0E-06
sp|C0LGU1|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1 764 1051 8.0E-06
sp|Q99983|OMD_HUMAN Osteomodulin OS=Homo sapiens GN=OMD PE=1 SV=1 735 983 8.0E-06
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 969 1075 9.0E-06
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 894 1079 9.0E-06
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 832 1009 9.0E-06
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 814 1052 9.0E-06
sp|Q05C16|LRC63_HUMAN Leucine-rich repeat-containing protein 63 OS=Homo sapiens GN=LRRC63 PE=2 SV=2 710 892 9.0E-06
sp|B7XK66|CCR4_ENTBH Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Enterocytozoon bieneusi (strain H348) GN=CCR4 PE=3 SV=1 969 1071 9.0E-06
sp|P51888|PRELP_HUMAN Prolargin OS=Homo sapiens GN=PRELP PE=1 SV=1 768 968 9.0E-06
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 732 918 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006171 cAMP biosynthetic process Yes
GO:0004016 adenylate cyclase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0009190 cyclic nucleotide biosynthetic process Yes
GO:0035556 intracellular signal transduction Yes
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0005515 protein binding Yes
GO:0009187 cyclic nucleotide metabolic process No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0009975 cyclase activity No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0140096 catalytic activity, acting on a protein No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0007165 signal transduction No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0044238 primary metabolic process No
GO:0016849 phosphorus-oxygen lyase activity No
GO:0065007 biological regulation No
GO:0046872 metal ion binding No
GO:0046483 heterocycle metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0046058 cAMP metabolic process No
GO:0052652 cyclic purine nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009987 cellular process No
GO:0016787 hydrolase activity No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0016829 lyase activity No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0050789 regulation of biological process No
GO:0006163 purine nucleotide metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0072521 purine-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2774
MSDKAAARFSSLTSASTSTDGSSRTVKPSTPPPPAPSSSASSLSASPSARYLQRSHRIHGDVDVSPDQRPRPPPH
DDAYVAVPRASLSPIPNGTGRNIDRRDGTALDASRANPSVAPWASSTPPPPPPKGPLTSSFYDDSSDGTSAASQF
SPALGLSGLRHGAVPPNIPESPDMSYFPVDARRPSLASITTASSQGSRTSGTRGGYRKLQGFFGEEFPGRDSSET
SLTASVVGKDQRARSYSHTRPSQRDRNFSNATDPRDASPSSSRPRTPVPSSQVVPFLYQDNNDIARYGEAPIRDI
MAGPDRERYEASSPAPQIPPKSSASSRSNEDPRGPRPATSRDASARAQSPAPGTNGGSKAGPAEPPTSPVKRGFL
GRLRRNKDKDKDKDKDKDKDRDRDRDRERERDRDRDRDRDRDRDRARDDGTPARPRDLPQPARPLQTKTSKADFS
RPALSPPQAQGHWPGSADAASRGQSFNKFPFARKTRPNQRYDYGDEAIGPTDHHQRSEPPDSSVFHLDTDLNDME
GILQAPATVVPPDAPAANNPDSERKDSAIEQPKGGWDAPDSWAVRRDTEDAAVVHDLDEAEESPRPEEKLAPYFI
RIFRSDGTFSTHSMPLDASSSDVISQVVKKTYVLDGLENYHIILKKHDLIRVLTAADRPLLLQKRLLQQVGYEDK
DRIEELGREDNGYLCRFMFLSARESDFHAKTNDLGVSRSQKLNHVDLSGRNLVTIPISLYSKAADITSLNLSRNL
SLDVPRDFIQSCKHLRDIKFTNNEARKLPLSLGRASRLTFLDVSNNRVEQLDNAELNSLTGLLKMNLANNRLTRL
PPYFDAYQALRSLNLSSNFLDAFPPFLCQLRSLVDLDMSFNAIARLPDEIGNLKNLEKFLITNNKLADEVPAGFR
GLTSLRELDIKFNAMTSIDIISELPKLEILCAAHNNVSSFSGKFERIRQLKLNSNPLNKFEFTESVPTLTTLNLS
HAQLVSIDSAFVNMINLERLILDRNHFVTIPQQVGVLSRLEHFSVANNAVAELPPQIGCLSELQVLDVRGNNISK
LPPEMWWAHRLETFNASSNVLDSFPKPSSKPPRAPGGEDAPSGSGPPPTQNGKLQAPTALAATPTEEEPPEERRP
SQGSSTLLSVGPSPVQAAADRKGSVVSVYGKGGRKTSVVSRAASSQAGSSSSCVTAPTNPRKDSGVSSSKLTATF
AGSLRNLYLADNRLDDDVFDQITLLPELRVLNLSYNEEISDMPQRSIRSWPQLVELYLSGNGLTSIPADDLEESS
LLQTLYINGNRFTNLPADISRAKKLAVFDCGNNFLKYNICNVPYDWNWNLNPNLRYLNLSGNKRLEIKQTGGGDG
PGAANREQYTDFNRLSNLRVLGLMDVTLTQPSIPDQSEDRRVRTSGSLAGHLPYGMADTLGKNEHLSTVDLVVPR
FNSSETEMLLGLFDGQALSSGGSKIAKYLHENFGHIFAMELKGLKTRQNETPVDALRRAFLALNKDLVTIAVQPQ
HAEERPKTSHRGGTAQPVVLSREDLNSGGVATVVYFQGTDLYVANVGDAQAMVIQTDGTHQMLTRKHDPAEASER
SRIREAGGWVSRNGRLNDLLQVSRAFGYVDLMPAVQAAPHVSSMKMGEHEDIILLATSELWEYLAPGLITDIARA
ERQDLMRAAQKLRDLAVAYGASGKIMVMMISVADLKRRMERSRLHRGASMSLYPSGVPDEAQVLSTRRGRKAKGD
VLDSSLGRLEAEIPAPTGNVSIAFTDIKNSTNLWEMYPSAMRSAIKLHNEVMRRQLRRIGGYEVKTEGDAFMVSF
PTATSALLWCFAVQLSLLDVNWPSEILSSMSGQAVYDKDNNLIFKGLSVRMGIHFGDCVSETDPVTRRMDYFGPM
VNKAARVSAVADGGQITVSTDFISEIQRCLETHQADSGRNGSAGTDDAFDDESHAAAIRKDLTSLTSQGFEVKEM
GEKKLKGLENPEMMYSLYPHGLAGRVDHHLQHERREVDGGAEKPRPAGPGAELSFDPDTLWALWNVSLRLEMLCS
SLEKDDGDGPALCPPETGILDRMKARAADVTDQFLVNFAEHQVSRIETCISTLAMRHLAVGGGPLRDLADLRAPM
DSVLDFFVQQKKELDLYRKTFGSLPRSDAVAEEVEDGDVDAEEGEAE
Coding >Ophio5|2774
ATGTCGGACAAGGCGGCCGCCCGCTTCAGCTCCCTCACGAGCGCAAGCACCAGCACCGACGGCAGCTCGCGCACC
GTCAAGCCCTCGACTCCGCCGCCGCCGGCCCCGTCGTCGTCCGCTTCGTCATTGTCCGCCTCGCCATCGGCCCGA
TACTTACAGCGTAGCCACCGCATCCACGGCGACGTTGACGTCAGTCCCGATCAACGGCCCAGACCGCCGCCGCAC
GACGATGCCTACGTCGCCGTCCCTCGTGCCTCGCTCTCGCCCATCCCTAATGGCACCGGCCGAAACATCGACCGC
CGAGACGGTACCGCGCTCGACGCCTCCCGCGCCAATCCCAGCGTGGCCCCTTGGGCTTCCAGCACGCCGCCCCCG
CCACCTCCGAAGGGCCCGCTGACGTCGAGCTTCTACGACGACTCGAGCGATGGCACCTCGGCCGCCTCGCAATTC
TCTCCGGCTCTGGGGCTCTCCGGACTTCGCCACGGCGCCGTGCCCCCCAACATACCCGAGTCCCCCGACATGTCC
TACTTCCCAGTCGACGCTCGCCGGCCCTCGCTCGCCAGCATCACCACAGCCAGTAGTCAGGGGTCCAGGACTAGC
GGCACGCGCGGCGGCTACCGCAAGCTCCAAGGCTTCTTTGGCGAGGAGTTCCCTGGGCGTGATAGCTCCGAGACT
AGCCTGACCGCATCCGTCGTCGGCAAGGACCAGCGCGCGCGATCCTACAGCCACACCCGCCCGTCCCAGCGCGAC
CGCAACTTCTCCAATGCCACCGATCCGAGGGACGCCTCACCTTCCTCATCACGCCCAAGGACACCCGTCCCCTCG
TCCCAGGTTGTGCCCTTCCTCTACCAGGACAACAACGACATTGCCCGTTACGGGGAGGCGCCCATCAGGGATATT
ATGGCCGGTCCAGACCGAGAGCGATACGAAGCCTCGTCTCCCGCGCCCCAGATCCCCCCCAAGTCTTCGGCCTCG
TCGCGGAGCAACGAGGACCCGAGAGGCCCTCGGCCCGCCACCAGCAGGGACGCATCAGCGAGGGCTCAGAGTCCG
GCGCCCGGCACCAACGGCGGCTCCAAAGCCGGCCCCGCCGAGCCGCCAACGTCGCCCGTCAAGAGAGGCTTCCTC
GGCCGCCTTCGTCGCAACAAGGACAAGGACAAGGACAAGGACAAGGACAAAGACAAGGACAGGGACAGGGATAGG
GACAGGGAAAGAGAAAGGGACCGGGACCGGGACCGGGACCGGGACCGGGACCGAGACCGAGCCCGAGACGACGGC
ACTCCCGCCCGACCCCGCGATCTTCCCCAGCCCGCTCGCCCTCTGCAGACCAAGACCTCCAAGGCCGACTTCTCG
AGGCCGGCCTTGTCTCCTCCGCAGGCCCAGGGTCACTGGCCCGGTAGTGCCGATGCCGCCTCTCGTGGCCAGTCG
TTCAACAAGTTTCCCTTTGCCAGGAAGACGCGGCCCAACCAGCGGTATGACTACGGTGACGAGGCCATCGGTCCC
ACGGACCATCATCAGCGGAGTGAGCCCCCCGACAGCAGCGTCTTCCACCTCGACACCGACCTCAACGATATGGAG
GGCATTCTGCAGGCCCCCGCCACCGTCGTGCCCCCGGACGCGCCCGCCGCCAACAACCCCGATTCCGAGCGCAAG
GACTCGGCCATTGAGCAGCCAAAGGGCGGCTGGGACGCGCCCGACAGCTGGGCTGTCCGCCGCGACACCGAGGAT
GCGGCCGTCGTCCACGATCTGGACGAGGCCGAGGAGTCGCCGCGACCCGAGGAGAAGCTGGCGCCCTACTTCATC
CGCATCTTCCGCTCCGACGGCACCTTCTCCACCCACTCGATGCCTCTCGACGCCTCCTCGTCAGATGTCATATCG
CAGGTCGTCAAGAAGACGTACGTCCTGGACGGGCTCGAGAACTACCACATCATTCTCAAGAAGCACGACCTCATC
CGCGTCCTGACGGCCGCCGACAGGCCCCTGCTCCTGCAGAAGCGGCTGCTGCAGCAGGTCGGCTACGAGGACAAG
GACAGGATCGAGGAGCTCGGCCGCGAAGACAATGGCTACCTCTGCCGCTTCATGTTCCTGTCGGCCAGGGAGAGC
GACTTCCACGCAAAGACCAACGATCTGGGCGTCTCGCGCTCTCAGAAGCTCAACCACGTCGACCTCTCGGGGCGC
AACCTCGTCACCATTCCCATCTCGCTCTACTCCAAGGCGGCTGACATCACCTCGCTTAACCTGTCGAGGAACCTG
TCGTTGGACGTGCCGCGAGACTTTATCCAGTCGTGCAAGCACCTGCGGGACATCAAGTTCACCAACAACGAAGCC
CGGAAGCTGCCGCTCAGCCTTGGCCGCGCCAGCAGGCTGACCTTCCTCGACGTCTCCAACAACAGGGTCGAGCAG
CTGGACAATGCCGAGCTCAACAGCCTCACGGGTCTGCTCAAGATGAACCTTGCCAACAACCGGCTGACGCGCCTC
CCGCCCTACTTCGACGCCTACCAGGCCCTGCGCAGCCTGAACCTCTCGTCCAACTTCCTCGATGCCTTCCCGCCC
TTTCTGTGCCAGTTGCGGAGCCTCGTCGACCTGGACATGAGCTTCAACGCCATTGCTCGGCTGCCGGACGAGATC
GGCAACCTCAAGAACCTGGAAAAGTTCCTCATCACTAACAACAAGCTCGCGGACGAGGTGCCGGCCGGTTTCCGC
GGTCTGACGAGCCTGCGCGAGCTCGACATCAAGTTCAACGCCATGACGAGCATCGACATCATCTCGGAGCTGCCC
AAGCTGGAGATTCTGTGCGCCGCCCACAACAACGTGTCTTCCTTCTCGGGCAAGTTTGAGCGCATCCGCCAGCTG
AAGCTCAACTCGAATCCGCTCAACAAGTTCGAGTTCACCGAGTCGGTCCCGACGCTGACGACGCTGAACCTGTCC
CATGCCCAGCTCGTGAGCATCGACTCGGCCTTTGTCAACATGATCAACCTGGAGCGCCTGATCCTGGACCGCAAT
CACTTTGTGACGATTCCTCAGCAGGTCGGGGTCCTGAGCAGGCTGGAGCACTTTAGCGTCGCCAACAACGCCGTG
GCCGAGCTGCCACCGCAGATCGGATGCCTCTCGGAGCTGCAGGTGCTGGACGTGCGCGGCAACAACATTTCGAAG
CTGCCCCCCGAGATGTGGTGGGCCCACAGGCTGGAGACGTTCAACGCCTCTTCCAACGTTCTCGACTCGTTCCCC
AAGCCGTCGTCGAAGCCGCCGCGAGCTCCGGGTGGGGAAGACGCGCCGTCGGGCTCGGGTCCCCCGCCGACGCAG
AACGGTAAGCTCCAGGCGCCGACGGCGCTCGCGGCCACGCCGACGGAGGAGGAGCCGCCGGAGGAACGGCGGCCG
AGCCAGGGCTCGAGCACGCTGCTCAGCGTGGGCCCGTCGCCCGTCCAGGCGGCGGCGGACCGCAAGGGCTCCGTC
GTGTCCGTCTACGGCAAGGGCGGGCGTAAGACTTCGGTGGTCTCGCGGGCAGCGTCGTCGCAGGCCGGGTCGTCG
AGCTCGTGCGTGACGGCACCGACCAATCCTAGGAAGGACTCGGGCGTGTCGTCGTCGAAGCTGACGGCGACGTTT
GCCGGGTCCCTGCGGAACCTTTACCTGGCCGACAACCGGCTCGACGACGACGTGTTTGACCAAATCACGCTGCTG
CCGGAGCTACGGGTTCTGAACTTGTCGTACAATGAGGAGATTAGCGACATGCCGCAGAGGTCGATCCGGAGCTGG
CCGCAGCTCGTCGAGCTGTATCTGTCGGGCAACGGGCTGACGAGCATCCCCGCCGACGACCTGGAGGAGTCGAGC
CTGCTGCAGACGCTGTACATCAACGGTAACCGCTTCACGAACCTGCCGGCCGACATCTCGCGGGCCAAGAAGCTG
GCCGTCTTCGACTGCGGCAACAACTTTCTCAAGTACAACATCTGCAACGTGCCGTACGACTGGAACTGGAACCTC
AACCCCAACCTGCGGTACCTCAACCTGTCGGGCAACAAGCGGCTGGAGATCAAGCAGACGGGCGGCGGCGACGGC
CCCGGGGCGGCCAACCGGGAGCAGTACACCGACTTCAACCGGCTGAGCAACCTGCGGGTGCTGGGCCTCATGGAC
GTGACGCTGACGCAGCCCAGCATCCCCGACCAGAGCGAGGACCGGCGCGTGCGGACCTCGGGCTCGCTGGCGGGG
CATTTGCCGTACGGCATGGCGGACACGCTCGGCAAGAATGAGCACCTGTCGACGGTGGACCTGGTGGTGCCGCGC
TTCAACTCTTCCGAGACGGAGATGCTGCTGGGCCTCTTCGACGGCCAGGCGCTGTCGAGCGGCGGGTCCAAGATT
GCCAAGTATCTGCACGAGAACTTTGGCCACATCTTCGCCATGGAGCTCAAGGGCCTCAAGACGCGGCAGAACGAG
ACGCCGGTGGACGCGCTGCGACGGGCGTTCCTGGCGCTCAACAAGGACCTGGTGACGATTGCGGTACAGCCGCAG
CACGCCGAGGAGCGACCCAAGACGTCGCATAGGGGGGGCACGGCGCAGCCGGTGGTGCTGAGCCGCGAGGACCTC
AACTCGGGCGGCGTGGCGACGGTCGTCTACTTCCAGGGCACCGACCTGTACGTGGCCAACGTCGGCGATGCCCAG
GCCATGGTGATACAGACGGACGGCACGCACCAGATGCTGACTCGGAAGCACGACCCGGCCGAGGCATCGGAGCGG
TCGCGCATCCGGGAGGCCGGCGGCTGGGTGTCGCGCAACGGCCGGCTCAACGACCTGCTGCAGGTATCGCGGGCC
TTTGGATACGTCGACCTGATGCCGGCCGTCCAGGCGGCTCCGCACGTCAGCAGCATGAAGATGGGCGAGCACGAG
GACATCATCCTTCTGGCGACGAGCGAGCTGTGGGAGTATCTGGCTCCGGGCCTCATCACCGACATCGCCCGGGCC
GAGCGCCAGGACCTGATGCGCGCGGCCCAGAAGCTGCGCGACCTGGCGGTGGCCTACGGAGCGTCTGGCAAGATC
ATGGTCATGATGATCAGCGTCGCCGACCTCAAGCGCCGCATGGAACGCTCCCGCCTGCACCGCGGCGCCAGCATG
TCGCTCTATCCCTCGGGCGTGCCGGACGAGGCTCAGGTGCTGTCGACGCGCAGGGGCCGCAAGGCCAAGGGCGAC
GTGCTCGACTCGTCGCTGGGCCGGCTGGAGGCGGAGATTCCGGCGCCGACGGGCAACGTGTCCATCGCCTTCACC
GACATCAAGAACTCGACCAACCTGTGGGAGATGTATCCGAGCGCCATGCGGTCCGCCATCAAGCTGCACAACGAG
GTGATGCGTCGCCAGCTGCGCCGTATCGGCGGCTACGAGGTCAAGACGGAGGGTGACGCCTTCATGGTGTCCTTT
CCCACCGCCACCTCGGCGCTGCTGTGGTGTTTCGCCGTTCAGCTGTCGCTCCTCGACGTCAACTGGCCTTCGGAG
ATTCTCAGCTCCATGTCGGGCCAGGCCGTCTACGACAAGGACAACAACCTCATCTTCAAGGGCCTCTCGGTCCGC
ATGGGCATTCACTTCGGCGACTGCGTCAGCGAGACGGACCCCGTCACGCGCCGCATGGATTACTTTGGGCCCATG
GTCAACAAGGCGGCCCGTGTCTCGGCCGTGGCCGACGGCGGACAGATCACCGTCTCGACCGACTTCATATCCGAG
ATACAGCGCTGTCTCGAGACGCACCAGGCCGATTCGGGCCGGAACGGCTCGGCCGGCACCGACGATGCCTTCGAC
GACGAGTCGCACGCGGCCGCCATCCGCAAGGACCTGACCTCGCTCACCTCGCAGGGCTTCGAGGTCAAGGAAATG
GGCGAGAAGAAGCTCAAGGGCCTCGAGAACCCGGAGATGATGTACTCGCTCTACCCGCACGGCCTGGCCGGCCGA
GTCGATCACCATCTGCAGCACGAGCGCCGCGAGGTCGACGGCGGCGCCGAGAAGCCCCGGCCGGCCGGACCGGGA
GCCGAATTGTCGTTCGACCCGGACACGCTGTGGGCGCTGTGGAACGTCAGCCTCAGGCTCGAGATGCTGTGCAGC
AGCCTGGAGAAGGACGACGGCGACGGGCCGGCCCTGTGTCCGCCCGAGACGGGCATCCTGGACCGCATGAAGGCG
AGGGCCGCCGACGTGACGGACCAGTTCCTGGTGAATTTTGCCGAGCATCAAGTGAGCCGGATAGAGACGTGCATC
TCCACGCTCGCTATGCGTCATCTCGCCGTCGGCGGCGGTCCACTGCGCGACCTTGCCGACCTGCGAGCGCCCATG
GACTCGGTGCTCGACTTCTTCGTACAGCAGAAGAAGGAGCTGGACCTGTATCGCAAGACGTTCGGCTCTCTGCCC
CGGTCCGACGCCGTCGCGGAGGAGGTGGAAGACGGCGATGTCGACGCCGAAGAAGGCGAGGCCGAG
Transcript >Ophio5|2774
ATGTCGGACAAGGCGGCCGCCCGCTTCAGCTCCCTCACGAGCGCAAGCACCAGCACCGACGGCAGCTCGCGCACC
GTCAAGCCCTCGACTCCGCCGCCGCCGGCCCCGTCGTCGTCCGCTTCGTCATTGTCCGCCTCGCCATCGGCCCGA
TACTTACAGCGTAGCCACCGCATCCACGGCGACGTTGACGTCAGTCCCGATCAACGGCCCAGACCGCCGCCGCAC
GACGATGCCTACGTCGCCGTCCCTCGTGCCTCGCTCTCGCCCATCCCTAATGGCACCGGCCGAAACATCGACCGC
CGAGACGGTACCGCGCTCGACGCCTCCCGCGCCAATCCCAGCGTGGCCCCTTGGGCTTCCAGCACGCCGCCCCCG
CCACCTCCGAAGGGCCCGCTGACGTCGAGCTTCTACGACGACTCGAGCGATGGCACCTCGGCCGCCTCGCAATTC
TCTCCGGCTCTGGGGCTCTCCGGACTTCGCCACGGCGCCGTGCCCCCCAACATACCCGAGTCCCCCGACATGTCC
TACTTCCCAGTCGACGCTCGCCGGCCCTCGCTCGCCAGCATCACCACAGCCAGTAGTCAGGGGTCCAGGACTAGC
GGCACGCGCGGCGGCTACCGCAAGCTCCAAGGCTTCTTTGGCGAGGAGTTCCCTGGGCGTGATAGCTCCGAGACT
AGCCTGACCGCATCCGTCGTCGGCAAGGACCAGCGCGCGCGATCCTACAGCCACACCCGCCCGTCCCAGCGCGAC
CGCAACTTCTCCAATGCCACCGATCCGAGGGACGCCTCACCTTCCTCATCACGCCCAAGGACACCCGTCCCCTCG
TCCCAGGTTGTGCCCTTCCTCTACCAGGACAACAACGACATTGCCCGTTACGGGGAGGCGCCCATCAGGGATATT
ATGGCCGGTCCAGACCGAGAGCGATACGAAGCCTCGTCTCCCGCGCCCCAGATCCCCCCCAAGTCTTCGGCCTCG
TCGCGGAGCAACGAGGACCCGAGAGGCCCTCGGCCCGCCACCAGCAGGGACGCATCAGCGAGGGCTCAGAGTCCG
GCGCCCGGCACCAACGGCGGCTCCAAAGCCGGCCCCGCCGAGCCGCCAACGTCGCCCGTCAAGAGAGGCTTCCTC
GGCCGCCTTCGTCGCAACAAGGACAAGGACAAGGACAAGGACAAGGACAAAGACAAGGACAGGGACAGGGATAGG
GACAGGGAAAGAGAAAGGGACCGGGACCGGGACCGGGACCGGGACCGGGACCGAGACCGAGCCCGAGACGACGGC
ACTCCCGCCCGACCCCGCGATCTTCCCCAGCCCGCTCGCCCTCTGCAGACCAAGACCTCCAAGGCCGACTTCTCG
AGGCCGGCCTTGTCTCCTCCGCAGGCCCAGGGTCACTGGCCCGGTAGTGCCGATGCCGCCTCTCGTGGCCAGTCG
TTCAACAAGTTTCCCTTTGCCAGGAAGACGCGGCCCAACCAGCGGTATGACTACGGTGACGAGGCCATCGGTCCC
ACGGACCATCATCAGCGGAGTGAGCCCCCCGACAGCAGCGTCTTCCACCTCGACACCGACCTCAACGATATGGAG
GGCATTCTGCAGGCCCCCGCCACCGTCGTGCCCCCGGACGCGCCCGCCGCCAACAACCCCGATTCCGAGCGCAAG
GACTCGGCCATTGAGCAGCCAAAGGGCGGCTGGGACGCGCCCGACAGCTGGGCTGTCCGCCGCGACACCGAGGAT
GCGGCCGTCGTCCACGATCTGGACGAGGCCGAGGAGTCGCCGCGACCCGAGGAGAAGCTGGCGCCCTACTTCATC
CGCATCTTCCGCTCCGACGGCACCTTCTCCACCCACTCGATGCCTCTCGACGCCTCCTCGTCAGATGTCATATCG
CAGGTCGTCAAGAAGACGTACGTCCTGGACGGGCTCGAGAACTACCACATCATTCTCAAGAAGCACGACCTCATC
CGCGTCCTGACGGCCGCCGACAGGCCCCTGCTCCTGCAGAAGCGGCTGCTGCAGCAGGTCGGCTACGAGGACAAG
GACAGGATCGAGGAGCTCGGCCGCGAAGACAATGGCTACCTCTGCCGCTTCATGTTCCTGTCGGCCAGGGAGAGC
GACTTCCACGCAAAGACCAACGATCTGGGCGTCTCGCGCTCTCAGAAGCTCAACCACGTCGACCTCTCGGGGCGC
AACCTCGTCACCATTCCCATCTCGCTCTACTCCAAGGCGGCTGACATCACCTCGCTTAACCTGTCGAGGAACCTG
TCGTTGGACGTGCCGCGAGACTTTATCCAGTCGTGCAAGCACCTGCGGGACATCAAGTTCACCAACAACGAAGCC
CGGAAGCTGCCGCTCAGCCTTGGCCGCGCCAGCAGGCTGACCTTCCTCGACGTCTCCAACAACAGGGTCGAGCAG
CTGGACAATGCCGAGCTCAACAGCCTCACGGGTCTGCTCAAGATGAACCTTGCCAACAACCGGCTGACGCGCCTC
CCGCCCTACTTCGACGCCTACCAGGCCCTGCGCAGCCTGAACCTCTCGTCCAACTTCCTCGATGCCTTCCCGCCC
TTTCTGTGCCAGTTGCGGAGCCTCGTCGACCTGGACATGAGCTTCAACGCCATTGCTCGGCTGCCGGACGAGATC
GGCAACCTCAAGAACCTGGAAAAGTTCCTCATCACTAACAACAAGCTCGCGGACGAGGTGCCGGCCGGTTTCCGC
GGTCTGACGAGCCTGCGCGAGCTCGACATCAAGTTCAACGCCATGACGAGCATCGACATCATCTCGGAGCTGCCC
AAGCTGGAGATTCTGTGCGCCGCCCACAACAACGTGTCTTCCTTCTCGGGCAAGTTTGAGCGCATCCGCCAGCTG
AAGCTCAACTCGAATCCGCTCAACAAGTTCGAGTTCACCGAGTCGGTCCCGACGCTGACGACGCTGAACCTGTCC
CATGCCCAGCTCGTGAGCATCGACTCGGCCTTTGTCAACATGATCAACCTGGAGCGCCTGATCCTGGACCGCAAT
CACTTTGTGACGATTCCTCAGCAGGTCGGGGTCCTGAGCAGGCTGGAGCACTTTAGCGTCGCCAACAACGCCGTG
GCCGAGCTGCCACCGCAGATCGGATGCCTCTCGGAGCTGCAGGTGCTGGACGTGCGCGGCAACAACATTTCGAAG
CTGCCCCCCGAGATGTGGTGGGCCCACAGGCTGGAGACGTTCAACGCCTCTTCCAACGTTCTCGACTCGTTCCCC
AAGCCGTCGTCGAAGCCGCCGCGAGCTCCGGGTGGGGAAGACGCGCCGTCGGGCTCGGGTCCCCCGCCGACGCAG
AACGGTAAGCTCCAGGCGCCGACGGCGCTCGCGGCCACGCCGACGGAGGAGGAGCCGCCGGAGGAACGGCGGCCG
AGCCAGGGCTCGAGCACGCTGCTCAGCGTGGGCCCGTCGCCCGTCCAGGCGGCGGCGGACCGCAAGGGCTCCGTC
GTGTCCGTCTACGGCAAGGGCGGGCGTAAGACTTCGGTGGTCTCGCGGGCAGCGTCGTCGCAGGCCGGGTCGTCG
AGCTCGTGCGTGACGGCACCGACCAATCCTAGGAAGGACTCGGGCGTGTCGTCGTCGAAGCTGACGGCGACGTTT
GCCGGGTCCCTGCGGAACCTTTACCTGGCCGACAACCGGCTCGACGACGACGTGTTTGACCAAATCACGCTGCTG
CCGGAGCTACGGGTTCTGAACTTGTCGTACAATGAGGAGATTAGCGACATGCCGCAGAGGTCGATCCGGAGCTGG
CCGCAGCTCGTCGAGCTGTATCTGTCGGGCAACGGGCTGACGAGCATCCCCGCCGACGACCTGGAGGAGTCGAGC
CTGCTGCAGACGCTGTACATCAACGGTAACCGCTTCACGAACCTGCCGGCCGACATCTCGCGGGCCAAGAAGCTG
GCCGTCTTCGACTGCGGCAACAACTTTCTCAAGTACAACATCTGCAACGTGCCGTACGACTGGAACTGGAACCTC
AACCCCAACCTGCGGTACCTCAACCTGTCGGGCAACAAGCGGCTGGAGATCAAGCAGACGGGCGGCGGCGACGGC
CCCGGGGCGGCCAACCGGGAGCAGTACACCGACTTCAACCGGCTGAGCAACCTGCGGGTGCTGGGCCTCATGGAC
GTGACGCTGACGCAGCCCAGCATCCCCGACCAGAGCGAGGACCGGCGCGTGCGGACCTCGGGCTCGCTGGCGGGG
CATTTGCCGTACGGCATGGCGGACACGCTCGGCAAGAATGAGCACCTGTCGACGGTGGACCTGGTGGTGCCGCGC
TTCAACTCTTCCGAGACGGAGATGCTGCTGGGCCTCTTCGACGGCCAGGCGCTGTCGAGCGGCGGGTCCAAGATT
GCCAAGTATCTGCACGAGAACTTTGGCCACATCTTCGCCATGGAGCTCAAGGGCCTCAAGACGCGGCAGAACGAG
ACGCCGGTGGACGCGCTGCGACGGGCGTTCCTGGCGCTCAACAAGGACCTGGTGACGATTGCGGTACAGCCGCAG
CACGCCGAGGAGCGACCCAAGACGTCGCATAGGGGGGGCACGGCGCAGCCGGTGGTGCTGAGCCGCGAGGACCTC
AACTCGGGCGGCGTGGCGACGGTCGTCTACTTCCAGGGCACCGACCTGTACGTGGCCAACGTCGGCGATGCCCAG
GCCATGGTGATACAGACGGACGGCACGCACCAGATGCTGACTCGGAAGCACGACCCGGCCGAGGCATCGGAGCGG
TCGCGCATCCGGGAGGCCGGCGGCTGGGTGTCGCGCAACGGCCGGCTCAACGACCTGCTGCAGGTATCGCGGGCC
TTTGGATACGTCGACCTGATGCCGGCCGTCCAGGCGGCTCCGCACGTCAGCAGCATGAAGATGGGCGAGCACGAG
GACATCATCCTTCTGGCGACGAGCGAGCTGTGGGAGTATCTGGCTCCGGGCCTCATCACCGACATCGCCCGGGCC
GAGCGCCAGGACCTGATGCGCGCGGCCCAGAAGCTGCGCGACCTGGCGGTGGCCTACGGAGCGTCTGGCAAGATC
ATGGTCATGATGATCAGCGTCGCCGACCTCAAGCGCCGCATGGAACGCTCCCGCCTGCACCGCGGCGCCAGCATG
TCGCTCTATCCCTCGGGCGTGCCGGACGAGGCTCAGGTGCTGTCGACGCGCAGGGGCCGCAAGGCCAAGGGCGAC
GTGCTCGACTCGTCGCTGGGCCGGCTGGAGGCGGAGATTCCGGCGCCGACGGGCAACGTGTCCATCGCCTTCACC
GACATCAAGAACTCGACCAACCTGTGGGAGATGTATCCGAGCGCCATGCGGTCCGCCATCAAGCTGCACAACGAG
GTGATGCGTCGCCAGCTGCGCCGTATCGGCGGCTACGAGGTCAAGACGGAGGGTGACGCCTTCATGGTGTCCTTT
CCCACCGCCACCTCGGCGCTGCTGTGGTGTTTCGCCGTTCAGCTGTCGCTCCTCGACGTCAACTGGCCTTCGGAG
ATTCTCAGCTCCATGTCGGGCCAGGCCGTCTACGACAAGGACAACAACCTCATCTTCAAGGGCCTCTCGGTCCGC
ATGGGCATTCACTTCGGCGACTGCGTCAGCGAGACGGACCCCGTCACGCGCCGCATGGATTACTTTGGGCCCATG
GTCAACAAGGCGGCCCGTGTCTCGGCCGTGGCCGACGGCGGACAGATCACCGTCTCGACCGACTTCATATCCGAG
ATACAGCGCTGTCTCGAGACGCACCAGGCCGATTCGGGCCGGAACGGCTCGGCCGGCACCGACGATGCCTTCGAC
GACGAGTCGCACGCGGCCGCCATCCGCAAGGACCTGACCTCGCTCACCTCGCAGGGCTTCGAGGTCAAGGAAATG
GGCGAGAAGAAGCTCAAGGGCCTCGAGAACCCGGAGATGATGTACTCGCTCTACCCGCACGGCCTGGCCGGCCGA
GTCGATCACCATCTGCAGCACGAGCGCCGCGAGGTCGACGGCGGCGCCGAGAAGCCCCGGCCGGCCGGACCGGGA
GCCGAATTGTCGTTCGACCCGGACACGCTGTGGGCGCTGTGGAACGTCAGCCTCAGGCTCGAGATGCTGTGCAGC
AGCCTGGAGAAGGACGACGGCGACGGGCCGGCCCTGTGTCCGCCCGAGACGGGCATCCTGGACCGCATGAAGGCG
AGGGCCGCCGACGTGACGGACCAGTTCCTGGTGAATTTTGCCGAGCATCAAGTGAGCCGGATAGAGACGTGCATC
TCCACGCTCGCTATGCGTCATCTCGCCGTCGGCGGCGGTCCACTGCGCGACCTTGCCGACCTGCGAGCGCCCATG
GACTCGGTGCTCGACTTCTTCGTACAGCAGAAGAAGGAGCTGGACCTGTATCGCAAGACGTTCGGCTCTCTGCCC
CGGTCCGACGCCGTCGCGGAGGAGGTGGAAGACGGCGATGTCGACGCCGAAGAAGGCGAGGCCGAGTGA
Gene >Ophio5|2774
ATGTCGGACAAGGCGGCCGCCCGCTTCAGCTCCCTCACGAGCGCAAGCACCAGCACCGACGGCAGCTCGCGCACC
GTCAAGCCCTCGACTCCGCCGCCGCCGGCCCCGTCGTCGTCCGCTTCGTCATTGTCCGCCTCGCCATCGGCCCGA
TACTTACAGCGTAGCCACCGCATCCACGGCGACGTTGACGTCAGTCCCGATCAACGGCCCAGGTAAGCCCAGCCT
TGTTTGCATCGCGACTTGCTTCTCCGCCGCCGCCGTCGCTCAAGGTACTCCTCTCAGACCGCCGCCGCACGACGA
TGCCTACGTCGCCGTCCCTCGTGCCTCGCTCTCGCCCATCCCTAATGGCACCGGCCGAAACATCGACCGCCGAGA
CGGTACCGCGCTCGACGCCTCCCGCGCCAATCCCAGCGTGGCCCCTTGGGCTTCCAGCACGCCGCCCCCGCCACC
TCCGAAGGGCCCGCTGACGTCGAGCTTCTACGACGACTCGAGCGATGGCACCTCGGCCGCCTCGCAATTCTCTCC
GGCTCTGGGGCTCTCCGGACTTCGCCACGGCGCCGTGCCCCCCAACATACCCGAGTCCCCCGACATGTCCTACTT
CCCAGTCGACGCTCGCCGGCCCTCGCTCGCCAGCATCACCACAGCCAGTAGTCAGGGGTCCAGGACTAGCGGCAC
GCGCGGCGGCTACCGCAAGCTCCAAGGCTTCTTTGGCGAGGAGTTCCCTGGGCGTGATAGCTCCGAGACTAGCCT
GACCGCATCCGTCGTCGGCAAGGACCAGCGCGCGCGATCCTACAGCCACACCCGCCCGTCCCAGCGCGACCGCAA
CTTCTCCAATGCCACCGATCCGAGGGACGCCTCACCTTCCTCATCACGCCCAAGGACACCCGTCCCCTCGTCCCA
GGTTGTGCCCTTCCTCTACCAGGACAACAACGTACGTCTCACTCCTCCCCCAAAATTTCCCTCCCACCGCTCGCC
TGCTGCCTCTTTTCTGGACGGGCGCTTCTCTTATTGCTGGGCCCCGTTACTTCTTCCCCCTCTCTCGCCAGTTCG
TACGAATCCGGCTGACTCCGGCGCTGCTCTAGGACATTGCCCGTTACGGGGAGGCGCCCATCAGGGATATTATGG
CCGGTCCAGACCGAGAGCGATACGAAGCCTCGTCTCCCGCGCCCCAGATCCCCCCCAAGTCTTCGGCCTCGTCGC
GGTCTGCAAAGCCCCTAGGCCACCTACCCGGCCACCACCGGCACCACAGGAGCAACGAGGACCCGAGAGGCCCTC
GGCCCGCCACCAGCAGGGACGCATCGTATACTACGGTAACGCCCAATCTCCGTGAACGCGGCTCTTCCGTCAACA
TGCCCGGCCAAAGAGCGAGGGCTCAGAGTCCGGCGCCCGGCACCAACGGCGGCTCCAAAGCCGGCCCCGCCGAGC
CGCCAACGTCGCCCGTCAAGAGAGGCTTCCTCGGCCGCCTTCGTCGCAACAAGGACAAGGACAAGGACAAGGACA
AGGACAAAGACAAGGACAGGGACAGGGATAGGGACAGGGAAAGAGAAAGGGACCGGGACCGGGACCGGGACCGGG
ACCGGGACCGAGACCGAGCCCGAGACGACGGCACTCCCGCCCGACCCCGCGATCTTCCCCAGCCCGCTCGCCCTC
TGCAGACCAAGACCTCCAAGGCCGACTTCTCGAGGCCGGCCTTGTCTCCTCCGCAGGCCCAGGGTCACTGGCCCG
GTAGTGCCGATGCCGCCTCTCGTGGCCAGTCGTTCAACAAGTTTCCCTTTGCCAGGAAGACGCGGCCCAACCAGC
GGTATGACTACGGTGACGAGGCCATCGGTCCCACGGACCATCATCAGCGGAGTGAGCCCCCCGACAGCAGCGTCT
TCCACCTCGACACCGACCTCAACGATATGGAGGGCATTCTGCAGGCCCCCGCCACCGTCGTGCCCCCGGACGCGC
CCGCCGCCAACAACCCCGATTCCGAGCGCAAGGACTCGGCCATTGAGCAGCCAAAGGGCGGCTGGGACGCGCCCG
ACAGCTGGGCTGTCCGCCGCGACACCGAGGATGCGGCCGTCGTCCACGATCTGGACGAGGCCGAGGAGTCGCCGC
GACCCGAGGAGAAGCTGGCGCCCTACTTCATCCGCATCTTCCGCTCCGACGGCACCTTCTCCACCCACTCGATGC
CTCTCGACGCCTCCTCGTCAGATGTCATATCGCAGGTCGTCAAGAAGACGTACGTCCTGGACGGGCTCGAGAACT
ACCACATCATTCTCAAGAAGCACGACCTCATCCGCGTCCTGACGGCCGCCGACAGGCCCCTGCTCCTGCAGAAGC
GGCTGCTGCAGCAGGTCGGCTACGAGGACAAGGACAGGATCGAGGAGCTCGGCCGCGAAGACAATGGCTACCTCT
GCCGCTTCATGTTCCTGTCGGCCAGGGAGAGCGACTTCCACGCAAAGACCAACGATCTGGGCGTCTCGCGCTCTC
AGAAGCTCAACCACGTCGACCTCTCGGGGCGCAACCTCGTCACCATTCCCATCTCGCTCTACTCCAAGGCGGCTG
ACATCACCTCGCTTAACCTGTCGAGGAACCTGTCGTTGGACGTGCCGCGAGACTTTATCCAGTCGTGCAAGCACC
TGCGGGACATCAAGTTCACCAACAACGAAGCCCGGAAGCTGCCGCTCAGCCTTGGCCGCGCCAGCAGGCTGACCT
TCCTCGACGTCTCCAACAACAGGGTCGAGCAGCTGGACAATGCCGAGCTCAACAGCCTCACGGGTCTGCTCAAGA
TGAACCTTGCCAACAACCGGCTGACGCGCCTCCCGCCCTACTTCGACGCCTACCAGGCCCTGCGCAGCCTGAACC
TCTCGTCCAACTTCCTCGATGCCTTCCCGCCCTTTCTGTGCCAGTTGCGGAGCCTCGTCGACCTGGACATGAGCT
TCAACGCCATTGCTCGGCTGCCGGACGAGATCGGCAACCTCAAGAACCTGGAAAAGTTCCTCATCACTAACAACA
AGCTCGCGGACGAGGTGCCGGCCGGTTTCCGCGGTCTGACGAGCCTGCGCGAGCTCGACATCAAGTTCAACGCCA
TGACGAGCATCGACATCATCTCGGAGCTGCCCAAGCTGGAGATTCTGTGCGCCGCCCACAACAACGTGTCTTCCT
TCTCGGGCAAGTTTGAGCGCATCCGCCAGCTGAAGCTCAACTCGAATCCGCTCAACAAGTTCGAGTTCACCGAGT
CGGTCCCGACGCTGACGACGCTGAACCTGTCCCATGCCCAGCTCGTGAGCATCGACTCGGCCTTTGTCAACATGA
TCAACCTGGAGCGCCTGATCCTGGACCGCAATCACTTTGTGACGATTCCTCAGCAGGTCGGGGTCCTGAGCAGGC
TGGAGCACTTTAGCGTCGCCAACAACGCCGTGGCCGAGCTGCCACCGCAGATCGGATGCCTCTCGGAGCTGCAGG
TGCTGGACGTGCGCGGCAACAACATTTCGAAGCTGCCCCCCGAGATGTGGTGGGCCCACAGGCTGGAGACGTTCA
ACGCCTCTTCCAACGTTCTCGACTCGTTCCCCAAGCCGTCGTCGAAGCCGCCGCGAGCTCCGGGTGGGGAAGACG
CGCCGTCGGGCTCGGGTCCCCCGCCGACGCAGAACGGTAAGCTCCAGGCGCCGACGGCGCTCGCGGCCACGCCGA
CGGAGGAGGAGCCGCCGGAGGAACGGCGGCCGAGCCAGGGCTCGAGCACGCTGCTCAGCGTGGGCCCGTCGCCCG
TCCAGGCGGCGGCGGACCGCAAGGGCTCCGTCGTGTCCGTCTACGGCAAGGGCGGGCGTAAGACTTCGGTGGTCT
CGCGGGCAGCGTCGTCGCAGGCCGGGTCGTCGAGCTCGTGCGTGACGGCACCGACCAATCCTAGGAAGGACTCGG
GCGTGTCGTCGTCGAAGCTGACGGCGACGTTTGCCGGGTCCCTGCGGAACCTTTACCTGGCCGACAACCGGCTCG
ACGACGACGTGTTTGACCAAATCACGCTGCTGCCGGAGCTACGGGTTCTGAACTTGTCGTACAATGAGGAGATTA
GCGACATGCCGCAGAGGTCGATCCGGAGCTGGCCGCAGCTCGTCGAGCTGTATCTGTCGGGCAACGGGCTGACGA
GCATCCCCGCCGACGACCTGGAGGAGTCGAGCCTGCTGCAGACGCTGTACATCAACGGTAACCGCTTCACGAACC
TGCCGGCCGACATCTCGCGGGCCAAGAAGCTGGCCGTCTTCGACTGCGGCAACAACTTTCTCAAGTACAACATCT
GCAACGTGCCGTACGACTGGAACTGGAACCTCAACCCCAACCTGCGGTACCTCAACCTGTCGGGCAACAAGCGGC
TGGAGATCAAGCAGACGGGCGGCGGCGACGGCCCCGGGGCGGCCAACCGGGAGCAGTACACCGACTTCAACCGGC
TGAGCAACCTGCGGGTGCTGGGCCTCATGGACGTGACGCTGACGCAGCCCAGCATCCCCGACCAGAGCGAGGACC
GGCGCGTGCGGACCTCGGGCTCGCTGGCGGGGCATTTGCCGTACGGCATGGCGGACACGCTCGGCAAGAATGAGC
ACCTGTCGACGGTGGACCTGGTGGTGCCGCGCTTCAACTCTTCCGAGACGGAGATGCTGCTGGGCCTCTTCGACG
GCCAGGCGCTGTCGAGCGGCGGGTCCAAGATTGCCAAGTATCTGCACGAGAACTTTGGCCACATCTTCGCCATGG
AGCTCAAGGGCCTCAAGACGCGGCAGAACGAGACGCCGGTGGACGCGCTGCGACGGGCGTTCCTGGCGCTCAACA
AGGACCTGGTGACGATTGCGGTACAGCCGCAGCACGCCGAGGAGCGACCCAAGACGTCGCATAGGGGGGGCACGG
CGCAGCCGGTGGTGCTGAGCCGCGAGGACCTCAACTCGGGCGGCGTGGCGACGGTCGTCTACTTCCAGGGCACCG
ACCTGTACGTGGCCAACGTCGGCGATGCCCAGGCCATGGTGATACAGACGGACGGCACGCACCAGATGCTGACTC
GGAAGCACGACCCGGCCGAGGCATCGGAGCGGTCGCGCATCCGGGAGGCCGGCGGCTGGGTGTCGCGCAACGGCC
GGCTCAACGACCTGCTGCAGGTATCGCGGGCCTTTGGATACGTCGACCTGATGCCGGCCGTCCAGGCGGCTCCGC
ACGTCAGCAGCATGAAGATGGGCGAGCACGAGGACATCATCCTTCTGGCGACGAGCGAGCTGTGGGAGTATCTGG
CTCCGGGCCTCATCACCGACATCGCCCGGGCCGAGCGCCAGGACCTGATGCGCGCGGCCCAGAAGCTGCGCGACC
TGGCGGTGGCCTACGGAGCGTCTGGCAAGATCATGGTCATGATGATCAGCGTCGCCGACCTCAAGCGCCGCATGG
AACGCTCCCGCCTGCACCGCGGCGCCAGCATGTCGCTCTATCCCTCGGGCGTGCCGGACGAGGCTCAGGTGCTGT
CGACGCGCAGGGGCCGCAAGGCCAAGGGCGACGTGCTCGACTCGTCGCTGGGCCGGCTGGAGGCGGAGATTCCGG
CGCCGACGGGCAACGTGTCCATCGCCTTCACCGACATCAAGAACTCGACCAACCTGTGGGAGATGTATCCGAGCG
CCATGCGGTCCGCCATCAAGCTGCACAACGAGGTGATGCGTCGCCAGCTGCGCCGTATCGGCGGCTACGAGGTCA
AGACGGAGGGTGACGCCTTCATGGTGTCCTTTCCCACCGCCACCTCGGCGCTGCTGTGGTGTTTCGCCGTTCAGC
TGTCGCTCCTCGACGTCAACTGGCCTTCGGAGATTCTCAGCTCCATGTCGGGCCAGGCCGTCTACGACAAGGACA
ACAACCTCATCTTCAAGGGCCTCTCGGTCCGCATGGGCATTCACTTCGGCGACTGCGTCAGCGAGACGGACCCCG
TCACGCGCCGCATGGATTACTTTGGGCCCATGGTCAACAAGGCGGCCCGTGTCTCGGCCGTGGCCGACGGCGGAC
AGATCACCGTCTCGACCGACTTCATATCCGAGATACAGCGCTGTCTCGAGACGCACCAGGCCGATTCGGGCCGGA
ACGGCTCGGCCGGCACCGACGATGCCTTCGACGACGAGTCGCACGCGGCCGCCATCCGCAAGGACCTGACCTCGC
TCACCTCGCAGGGCTTCGAGGTCAAGGAAATGGGCGAGAAGAAGCTCAAGGGCCTCGAGAACCCGGAGATGATGT
ACTCGCTCTACCCGCACGGCCTGGCCGGCCGAGTCGATCACCATCTGCAGCACGAGCGCCGCGAGGTCGACGGCG
GCGCCGAGAAGCCCCGGCCGGCCGGACCGGGAGCCGAATTGTCGTTCGACCCGGACACGCTGTGGGCGCTGTGGA
ACGTCAGCCTCAGGCTCGAGATGCTGTGCAGCAGCCTGGAGAAGGACGACGGCGACGGGCCGGCCCTGTGTCCGC
CCGAGACGGGCATCCTGGACCGCATGAAGGCGAGGGCCGCCGACGTGACGGACCAGTTCCTGGTGAATTTTGCCG
AGCATCAAGTGAGCCGGATAGAGGTTATTTTTCCCTCCCCTTTCACGTGCGTCTTGTCGCGGCTGACACGCTCCG
TCCTAGACGTGCATCTCCACGCTCGCTATGCGTCATCTCGCCGTCGGCGGCGGTCCACTGCGCGACCTTGCCGAC
CTGCGAGCGCCCATGGACTCGGTGCTCGACTTCTTCGTACAGCAGAAGAAGGAGCTGGACCTGTATCGCAAGACG
TTCGGCTCTCTGCCCCGGTCCGACGCCGTCGCGGAGGAGGTGGAAGACGGCGATGTCGACGCCGAAGAAGGCGAG
GCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail