Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2757
Gene name
Locationscaffold_221:12185..13003
Strand-
Gene length (bp)818
Transcript length (bp)747
Coding sequence length (bp)744
Protein length (aa) 248

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B5D4|SOD5_ARTBC Cell surface Cu-only superoxide dismutase ARB_03674 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03674 PE=1 SV=1 1 210 6.0E-43
sp|Q5ACV9|SOD6_CANAL Cell surface superoxide dismutase [Cu-Zn] 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD6 PE=1 SV=1 15 209 1.0E-26
sp|Q5AD07|SOD5_CANAL Cell surface Cu-only superoxide dismutase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD5 PE=1 SV=1 53 198 5.0E-25
sp|Q5AD05|SOD4_CANAL Cell surface superoxide dismutase [Cu-Zn] 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD4 PE=1 SV=1 41 197 5.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2757
MRAALIATASLSAGLVAAQATQDAPVIKANPSGATYEATLPAQAFTKGSLDGNVKGSIIASTPADGVGVEFKVNF
ENIPQEAGPFLYHIHVDPVPADGNCTKTLSHLDPYGRGEDTPCDSSRPQTCQVGDLSGKHGKPNSTSSNSFTADY
VDKFLSTSPESNAFFGNRSFVFHFANKTRITCANFQKIDSSTGVASSTASSPANIPVGTGGVLGPSESTVPFRGD
AAMLSLSLPLTLLSMAAVAVFAF
Coding >Ophio5|2757
ATGCGTGCCGCTCTCATCGCTACCGCCTCTCTTTCCGCTGGCCTCGTCGCCGCTCAGGCTACCCAAGATGCTCCC
GTCATCAAGGCCAACCCTTCAGGCGCCACCTACGAGGCCACGCTGCCCGCCCAGGCCTTCACCAAGGGCTCTCTC
GATGGAAACGTCAAGGGCTCCATCATCGCTAGCACTCCTGCTGATGGTGTCGGTGTCGAGTTCAAGGTCAACTTT
GAAAACATTCCCCAAGAGGCCGGGCCCTTCCTCTATCACATTCACGTTGATCCCGTCCCTGCCGATGGCAACTGC
ACAAAGACGCTCTCTCATTTGGATCCTTACGGCCGGGGCGAAGACACGCCGTGCGACTCGTCTCGTCCCCAGACG
TGCCAAGTCGGCGACTTGAGTGGAAAACATGGTAAACCAAACTCGACTTCGTCCAATTCCTTCACTGCCGACTAC
GTCGATAAGTTCCTGTCGACCAGCCCAGAGTCCAACGCCTTCTTCGGCAATCGATCCTTCGTCTTCCACTTTGCC
AACAAGACGCGCATCACCTGCGCCAACTTCCAAAAGATCGACTCCTCAACCGGCGTCGCCAGCTCGACCGCGAGC
TCGCCCGCTAACATCCCCGTCGGCACTGGTGGCGTTCTCGGCCCCAGCGAGTCGACGGTGCCCTTCCGTGGCGAC
GCCGCCATGTTGAGTCTCTCTCTTCCGCTGACGCTATTGTCCATGGCTGCCGTCGCCGTCTTTGCGTTT
Transcript >Ophio5|2757
ATGCGTGCCGCTCTCATCGCTACCGCCTCTCTTTCCGCTGGCCTCGTCGCCGCTCAGGCTACCCAAGATGCTCCC
GTCATCAAGGCCAACCCTTCAGGCGCCACCTACGAGGCCACGCTGCCCGCCCAGGCCTTCACCAAGGGCTCTCTC
GATGGAAACGTCAAGGGCTCCATCATCGCTAGCACTCCTGCTGATGGTGTCGGTGTCGAGTTCAAGGTCAACTTT
GAAAACATTCCCCAAGAGGCCGGGCCCTTCCTCTATCACATTCACGTTGATCCCGTCCCTGCCGATGGCAACTGC
ACAAAGACGCTCTCTCATTTGGATCCTTACGGCCGGGGCGAAGACACGCCGTGCGACTCGTCTCGTCCCCAGACG
TGCCAAGTCGGCGACTTGAGTGGAAAACATGGTAAACCAAACTCGACTTCGTCCAATTCCTTCACTGCCGACTAC
GTCGATAAGTTCCTGTCGACCAGCCCAGAGTCCAACGCCTTCTTCGGCAATCGATCCTTCGTCTTCCACTTTGCC
AACAAGACGCGCATCACCTGCGCCAACTTCCAAAAGATCGACTCCTCAACCGGCGTCGCCAGCTCGACCGCGAGC
TCGCCCGCTAACATCCCCGTCGGCACTGGTGGCGTTCTCGGCCCCAGCGAGTCGACGGTGCCCTTCCGTGGCGAC
GCCGCCATGTTGAGTCTCTCTCTTCCGCTGACGCTATTGTCCATGGCTGCCGTCGCCGTCTTTGCGTTTTGA
Gene >Ophio5|2757
ATGCGTGCCGCTCTCATCGCTACCGCCTCTCTTTCCGCTGGCCTCGTCGCCGCTCAGGCTACCCAAGATGCTCCC
GTCATCAAGGCCAACCCTTCAGGCGCCACCTACGAGGCCACGCTGCCCGCCCAGGCCTTCACCAAGGGCTCTCTC
GATGGAAACGTCAAGGGCTCCATCATCGCTAGCACTCCTGCTGATGGTGTCGGTGTCGAGTTCAAGGTCAACTTT
GAAAACATTCCCCAAGAGGCCGGGCCCTTCCGTCAGTCAAATTTCAATCTCCTTACTTCATTTCGAGAAAATACC
ACTGACCGAAATTGTCTCCCTTTGTAGTCTATCACATTCACGTTGATCCCGTCCCTGCCGATGGCAACTGCACAA
AGACGCTCTCTCATTTGGATCCTTACGGCCGGGGCGAAGACACGCCGTGCGACTCGTCTCGTCCCCAGACGTGCC
AAGTCGGCGACTTGAGTGGAAAACATGGTAAACCAAACTCGACTTCGTCCAATTCCTTCACTGCCGACTACGTCG
ATAAGTTCCTGTCGACCAGCCCAGAGTCCAACGCCTTCTTCGGCAATCGATCCTTCGTCTTCCACTTTGCCAACA
AGACGCGCATCACCTGCGCCAACTTCCAAAAGATCGACTCCTCAACCGGCGTCGCCAGCTCGACCGCGAGCTCGC
CCGCTAACATCCCCGTCGGCACTGGTGGCGTTCTCGGCCCCAGCGAGTCGACGGTGCCCTTCCGTGGCGACGCCG
CCATGTTGAGTCTCTCTCTTCCGCTGACGCTATTGTCCATGGCTGCCGTCGCCGTCTTTGCGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail