Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2745
Gene name
Locationscaffold_220:10447..12587
Strand+
Gene length (bp)2140
Transcript length (bp)1812
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 2.4E-136 168 603

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36209|STS1_SCHPO Delta(24(24(1)))-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts1 PE=1 SV=2 163 603 3.0E-150
sp|P25340|ERG4_YEAST Delta(24(24(1)))-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG4 PE=1 SV=2 168 603 7.0E-146
sp|Q54PP1|ERG24_DICDI Delta(14)-sterol reductase OS=Dictyostelium discoideum GN=erg24 PE=3 SV=1 134 600 1.0E-66
sp|O08984|LBR_RAT Lamin-B receptor OS=Rattus norvegicus GN=Lbr PE=1 SV=1 93 603 2.0E-50
sp|P23913|LBR_CHICK Lamin-B receptor OS=Gallus gallus GN=LBR PE=1 SV=1 73 599 3.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36209|STS1_SCHPO Delta(24(24(1)))-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts1 PE=1 SV=2 163 603 3.0E-150
sp|P25340|ERG4_YEAST Delta(24(24(1)))-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG4 PE=1 SV=2 168 603 7.0E-146
sp|Q54PP1|ERG24_DICDI Delta(14)-sterol reductase OS=Dictyostelium discoideum GN=erg24 PE=3 SV=1 134 600 1.0E-66
sp|O08984|LBR_RAT Lamin-B receptor OS=Rattus norvegicus GN=Lbr PE=1 SV=1 93 603 2.0E-50
sp|P23913|LBR_CHICK Lamin-B receptor OS=Gallus gallus GN=LBR PE=1 SV=1 73 599 3.0E-48
sp|Q3U9G9|LBR_MOUSE Lamin-B receptor OS=Mus musculus GN=Lbr PE=1 SV=2 61 603 2.0E-46
sp|Q5R7H4|LBR_PONAB Lamin-B receptor OS=Pongo abelii GN=LBR PE=2 SV=1 236 603 4.0E-46
sp|Q14739|LBR_HUMAN Lamin-B receptor OS=Homo sapiens GN=LBR PE=1 SV=2 236 603 3.0E-45
sp|Q71KT5|ERG24_MOUSE Delta(14)-sterol reductase OS=Mus musculus GN=Tm7sf2 PE=1 SV=2 169 603 2.0E-44
sp|P32462|ERG24_YEAST Delta(14)-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG24 PE=1 SV=1 168 603 2.0E-44
sp|Q09195|ERG24_SCHPO Delta(14)-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg24 PE=2 SV=1 168 603 7.0E-44
sp|O76062|ERG24_HUMAN Delta(14)-sterol reductase OS=Homo sapiens GN=TM7SF2 PE=2 SV=3 243 603 2.0E-42
sp|Q8WMV1|ERG24_BOVIN Delta(14)-sterol reductase OS=Bos taurus GN=TM7SF2 PE=1 SV=1 243 603 2.0E-40
sp|P78575|ERG24_ASCIM Delta(14)-sterol reductase OS=Ascobolus immersus GN=ERG3 PE=3 SV=1 168 603 2.0E-39
sp|P38670|ERG24_NEUCR Delta(14)-sterol reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-3 PE=3 SV=1 168 603 8.0E-39
sp|Q5UQI4|DHCR7_MIMIV Probable 7-dehydrocholesterol reductase OS=Acanthamoeba polyphaga mimivirus GN=DHCR7 PE=3 SV=1 265 603 9.0E-33
sp|Q9LDU6|ST7R_ARATH 7-dehydrocholesterol reductase OS=Arabidopsis thaliana GN=DWF5 PE=1 SV=1 228 603 4.0E-31
sp|Q01447|ERG24_FUSSO Delta(14)-sterol reductase OS=Fusarium solani subsp. pisi PE=3 SV=1 169 603 5.0E-31
sp|Q9LDR4|ERG24_ARATH Delta(14)-sterol reductase OS=Arabidopsis thaliana GN=FK PE=1 SV=2 239 603 2.0E-30
sp|Q5E9J5|DHCR7_BOVIN 7-dehydrocholesterol reductase OS=Bos taurus GN=DHCR7 PE=2 SV=1 134 603 2.0E-29
sp|Q7SXF1|DHCR7_DANRE 7-dehydrocholesterol reductase OS=Danio rerio GN=dhcr7 PE=2 SV=1 281 603 3.0E-29
sp|Q6P4M0|DHCR7_XENTR 7-dehydrocholesterol reductase OS=Xenopus tropicalis GN=dhcr7 PE=2 SV=1 158 603 4.0E-29
sp|Q7ZXH1|DHCR7_XENLA 7-dehydrocholesterol reductase OS=Xenopus laevis GN=dhcr7 PE=2 SV=1 131 603 4.0E-29
sp|O88455|DHCR7_MOUSE 7-dehydrocholesterol reductase OS=Mus musculus GN=Dhcr7 PE=1 SV=1 298 603 1.0E-25
sp|Q9Z2Z8|DHCR7_RAT 7-dehydrocholesterol reductase OS=Rattus norvegicus GN=Dhcr7 PE=2 SV=1 298 603 2.0E-25
sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens GN=DHCR7 PE=1 SV=1 298 603 3.0E-25
sp|O13597|ERG24_SEPLY Delta(14)-sterol reductase OS=Septoria lycopersici GN=ERG3 PE=3 SV=1 306 603 5.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Yes
GO:0016126 sterol biosynthetic process Yes
GO:0110165 cellular anatomical entity No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0016491 oxidoreductase activity No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0008202 steroid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0016125 sterol metabolic process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0006694 steroid biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 171 193 22
2 233 255 22
3 276 298 22
4 303 325 22
5 386 405 19
6 425 447 22
7 460 477 17
8 542 564 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2745
MSRYSLRQTPRKKELFDGMVATPVRRRSSRRQSSFPQDVSDLDNDSSSAAETSTRARSVRDRRSAAKLVEHVEED
EDEDEDDDEANTADDASVKPRVSTRATSNGAVTSVKTRSSARLISSSVSDAHVQPRKRALSHRTAPKSQATSTPR
VVDGWKPGQDPKVDVSGEFEFGGPLGTASMMILFPLLMWYMWLGATYFDGKLPSPTPDQTWLQFGAQMVSLVYKG
AFPHAAAWLWYWSYLVFQAACYCLLPGVWGRGKPLPHEGGKQLDYFCNAYASLYFTLAVLAALHFSGLWPLYLAL
DHFGPLLSVAIISGFLVSVAAYVSALYRGKQHRMTGHAVYDFFMGAELNPRMFGILDFKMFCEVRMPWYMLLILS
LGAAARQYDRYGYVSAEVLFLVMAHYLYANACAKGEELIITTWDMYYEKWGFMLIFWNLAGVPLSYCHCTIYLAN
HDPLEYRWNRWALAALYVAYLFWYWVWDSCNSQKNRFRAMESGQLVSRNTFPQVPWQTLHNPETIQSPQGTILVD
GWYGLARKIHYTADVWFAISWGLITGFKSPFPWFYPVFFCCMITHRAWRDIHRCRIKYGDAWLEYERRVPYLFIP
YVF
Coding >Ophio5|2745
ATGTCGAGATACTCGCTTCGCCAAACGCCGAGGAAGAAAGAACTCTTCGATGGCATGGTCGCGACGCCGGTCAGG
CGCCGGTCGTCGCGTCGCCAATCCTCCTTTCCTCAAGACGTCTCCGATCTCGACAACGATTCGAGCTCGGCCGCT
GAGACGTCGACGCGCGCCCGCTCCGTCCGTGACCGCCGCTCGGCTGCCAAGTTGGTTGAACATGTCGAAGAGGAC
GAGGACGAGGACGAGGATGACGACGAGGCTAACACCGCCGACGACGCGTCTGTGAAGCCGAGGGTCAGTACTCGC
GCCACGTCCAATGGCGCCGTCACGTCTGTCAAGACGAGGTCCAGCGCGCGCCTCATCTCCAGCAGTGTATCCGAC
GCCCATGTACAGCCCAGGAAGCGCGCCCTTTCCCACCGTACCGCGCCCAAGTCCCAAGCGACCTCGACACCACGA
GTCGTCGACGGCTGGAAACCTGGCCAGGATCCCAAGGTCGACGTCTCGGGCGAGTTCGAATTCGGCGGCCCGCTG
GGCACGGCCTCGATGATGATCCTCTTTCCCCTTCTCATGTGGTATATGTGGCTCGGCGCCACCTATTTCGACGGC
AAGCTTCCGTCCCCGACGCCGGACCAGACCTGGCTCCAGTTCGGCGCCCAAATGGTCAGCCTCGTCTACAAGGGC
GCGTTCCCCCACGCCGCCGCCTGGCTCTGGTACTGGTCCTACCTCGTCTTCCAGGCCGCCTGCTACTGTCTGCTA
CCGGGCGTCTGGGGTCGGGGCAAGCCTCTGCCCCATGAGGGCGGCAAGCAGTTGGACTACTTTTGCAACGCCTAC
GCCAGCCTGTACTTTACCCTCGCCGTCCTCGCCGCCTTGCACTTCTCCGGCCTCTGGCCGCTCTATCTGGCCCTC
GACCACTTCGGCCCTTTGCTGTCCGTCGCCATCATCAGCGGCTTTCTTGTCAGCGTCGCCGCCTACGTCTCCGCC
CTATACAGGGGCAAGCAGCATCGCATGACGGGACACGCCGTCTACGACTTCTTCATGGGCGCCGAGCTGAATCCG
CGCATGTTTGGCATCCTCGACTTCAAGATGTTCTGCGAGGTTCGCATGCCCTGGTACATGTTGCTCATCCTCAGC
CTGGGCGCCGCCGCTCGCCAGTACGACCGCTACGGCTACGTCTCCGCCGAGGTGCTCTTCCTCGTCATGGCGCAT
TATCTGTACGCCAACGCCTGCGCCAAGGGCGAGGAGCTCATCATCACCACCTGGGACATGTACTACGAGAAATGG
GGCTTCATGCTCATCTTCTGGAACTTGGCCGGCGTCCCGCTCTCGTACTGCCACTGCACCATCTACCTCGCCAAC
CACGACCCTTTGGAATATCGCTGGAACCGCTGGGCCCTGGCTGCCCTCTACGTCGCCTATCTGTTCTGGTACTGG
GTCTGGGACAGCTGCAACAGCCAGAAGAACCGGTTCCGCGCCATGGAGAGCGGCCAGCTCGTCAGCCGCAACACC
TTTCCCCAGGTGCCCTGGCAGACGCTCCACAATCCGGAGACGATACAGTCGCCGCAGGGCACCATCCTCGTCGAT
GGCTGGTACGGTCTCGCGCGCAAGATTCACTACACGGCCGATGTCTGGTTCGCCATCTCGTGGGGACTCATCACG
GGCTTCAAGAGCCCCTTCCCGTGGTTCTACCCCGTCTTCTTCTGCTGCATGATTACCCACCGCGCCTGGCGCGAC
ATTCATCGCTGCCGCATCAAATACGGCGATGCCTGGCTAGAGTACGAGCGACGGGTGCCGTACCTCTTCATCCCC
TACGTCTTC
Transcript >Ophio5|2745
ATGTCGAGATACTCGCTTCGCCAAACGCCGAGGAAGAAAGAACTCTTCGATGGCATGGTCGCGACGCCGGTCAGG
CGCCGGTCGTCGCGTCGCCAATCCTCCTTTCCTCAAGACGTCTCCGATCTCGACAACGATTCGAGCTCGGCCGCT
GAGACGTCGACGCGCGCCCGCTCCGTCCGTGACCGCCGCTCGGCTGCCAAGTTGGTTGAACATGTCGAAGAGGAC
GAGGACGAGGACGAGGATGACGACGAGGCTAACACCGCCGACGACGCGTCTGTGAAGCCGAGGGTCAGTACTCGC
GCCACGTCCAATGGCGCCGTCACGTCTGTCAAGACGAGGTCCAGCGCGCGCCTCATCTCCAGCAGTGTATCCGAC
GCCCATGTACAGCCCAGGAAGCGCGCCCTTTCCCACCGTACCGCGCCCAAGTCCCAAGCGACCTCGACACCACGA
GTCGTCGACGGCTGGAAACCTGGCCAGGATCCCAAGGTCGACGTCTCGGGCGAGTTCGAATTCGGCGGCCCGCTG
GGCACGGCCTCGATGATGATCCTCTTTCCCCTTCTCATGTGGTATATGTGGCTCGGCGCCACCTATTTCGACGGC
AAGCTTCCGTCCCCGACGCCGGACCAGACCTGGCTCCAGTTCGGCGCCCAAATGGTCAGCCTCGTCTACAAGGGC
GCGTTCCCCCACGCCGCCGCCTGGCTCTGGTACTGGTCCTACCTCGTCTTCCAGGCCGCCTGCTACTGTCTGCTA
CCGGGCGTCTGGGGTCGGGGCAAGCCTCTGCCCCATGAGGGCGGCAAGCAGTTGGACTACTTTTGCAACGCCTAC
GCCAGCCTGTACTTTACCCTCGCCGTCCTCGCCGCCTTGCACTTCTCCGGCCTCTGGCCGCTCTATCTGGCCCTC
GACCACTTCGGCCCTTTGCTGTCCGTCGCCATCATCAGCGGCTTTCTTGTCAGCGTCGCCGCCTACGTCTCCGCC
CTATACAGGGGCAAGCAGCATCGCATGACGGGACACGCCGTCTACGACTTCTTCATGGGCGCCGAGCTGAATCCG
CGCATGTTTGGCATCCTCGACTTCAAGATGTTCTGCGAGGTTCGCATGCCCTGGTACATGTTGCTCATCCTCAGC
CTGGGCGCCGCCGCTCGCCAGTACGACCGCTACGGCTACGTCTCCGCCGAGGTGCTCTTCCTCGTCATGGCGCAT
TATCTGTACGCCAACGCCTGCGCCAAGGGCGAGGAGCTCATCATCACCACCTGGGACATGTACTACGAGAAATGG
GGCTTCATGCTCATCTTCTGGAACTTGGCCGGCGTCCCGCTCTCGTACTGCCACTGCACCATCTACCTCGCCAAC
CACGACCCTTTGGAATATCGCTGGAACCGCTGGGCCCTGGCTGCCCTCTACGTCGCCTATCTGTTCTGGTACTGG
GTCTGGGACAGCTGCAACAGCCAGAAGAACCGGTTCCGCGCCATGGAGAGCGGCCAGCTCGTCAGCCGCAACACC
TTTCCCCAGGTGCCCTGGCAGACGCTCCACAATCCGGAGACGATACAGTCGCCGCAGGGCACCATCCTCGTCGAT
GGCTGGTACGGTCTCGCGCGCAAGATTCACTACACGGCCGATGTCTGGTTCGCCATCTCGTGGGGACTCATCACG
GGCTTCAAGAGCCCCTTCCCGTGGTTCTACCCCGTCTTCTTCTGCTGCATGATTACCCACCGCGCCTGGCGCGAC
ATTCATCGCTGCCGCATCAAATACGGCGATGCCTGGCTAGAGTACGAGCGACGGGTGCCGTACCTCTTCATCCCC
TACGTCTTCTAG
Gene >Ophio5|2745
ATGTCGAGATACTCGCTTCGCCAAACGCCGAGGTACGCGCCGCGCATCGGGAGAGTCGCAAACCATGGGCCATTG
CCCTTTTTTTTTTTTTTTTTTTTTTCCAAATCGCGCTCCGAGTCTGACTCTCTCTCTCCCTCTCTCTTAGGAAGA
AAGAACTCTTCGATGGCATGGTCGCGACGCCGGTCAGGCGCCGGTCGTCGCGTCGCCAATCCTCCTTTCCTCAAG
ACGTCTCCGATCTCGACAACGATTCGAGCTCGGCCGCTGAGACGTCGACGCGCGCCCGCTCCGTCCGTGACCGCC
GCTCGGCTGCCAAGTTGGTTGAACATGTCGAAGAGGACGAGGACGAGGACGAGGATGACGACGAGGCTAACACCG
CCGACGACGCGTCTGTGAAGCCGAGGGTCAGTACTCGCGCCACGTCCAATGGCGCCGTCACGTCTGTCAAGACGA
GGTCCAGCGCGCGCCTCATCTCCAGCAGTGTATCCGACGCCCATGTACAGCCCAGGAAGCGCGCCCTTTCCCACC
GTACCGCGCCCAAGTCCCAAGCGACCTCGACACCACGAGTCGTCGACGGCTGGAAACCTGGCCAGGATCCCAAGG
TCGACGTCTCGGGCGAGTTCGAATTCGGCGGCCCGCTGGGCACGGCCTCGATGATGATCCTCTTTCCCCTTCTCA
TGTGGTATATGTGGCTCGGCGCCACCTATTTCGACGGCAAGCTTCCGTCCCCGACGCCGGACCAGACCTGGCTCC
AGTTCGGCGCCCAAATGGTCAGCCTCGTCTACAAGGGCGCGTTCCCCCACGCCGCCGCCTGGCTCTGGTACTGGT
CCTACCTCGTCTTCCAGGCCGCCTGCTACTGTCTGCTACCGGGCGTCTGGGGTCGGGGCAAGCCTCTGCCCCATG
AGGGCGGCAAGCAGTTGGACTACTTTTGCAACGCCTACGCCAGCCTGTACTTTACCCTCGCCGTCCTCGCCGCCT
TGCACTTCTCCGGCCTCTGGCCGCTCTATCTGGCCCTCGACCACTTCGGCCCTTTGCTGTCCGTCGCCATCATCA
GCGGCTTTCTTGTCAGCGTCGCCGCCTACGTCTCCGCCCTATACAGGGGCAAGCAGCATCGCATGACGGGACACG
CCGTCTACGACTTCTTCATGGGCGCCGAGCTGAATCCGCGCATGTTTGGCATCCTCGACTTCAAGATGTTCTGCG
AGGTTCGCATGCCCTGGTACATGTTGCTCATCCTCAGCCTGGGCGCCGCCGCTCGCCAGTACGACCGCTACGGCT
ACGTCTCCGCCGAGGTGCTCTTCCTCGTCATGGCGCATTATCTGTACGCCAACGCCTGCGCCAAGGGCGAGGAGC
TCATCATCACCACCTGGTGAGCCCCGTCACCTCCTTCCCTCTCCCCCTTTCTCTGTCCTTTCTAGATGGTGACTG
ACGCCGTTGCAGGGACATGTACTACGAGAAATGGGGCTTCATGCTCATCTTCTGGAACTTGGCCGGCGTCCCGCT
CTCGTACTGCCACTGCACCATCTACCTCGCCAACCACGACCCTTTGGAATATCGCTGGAACCGCTGGGCCCTGGC
TGCCCTCTACGTCGCCTATCTGTTCTGGTACTGGGTCTGGGACAGCTGCAACAGCCAGAAGAACCGGTTCCGCGC
CATGGAGAGCGGCCAGCTCGTCAGCCGCAACACCTTTCCCCAGGTGCCCTGGCAGACGCTCCACAATCCGGAGAC
GATACAGTCGCCGCAGGGCACCATCCTCGTCGATGGCTGGTACGGTCTCGCGCGCAAGATTCACTACACGGCCGA
TGTCTGGTTCGCCATCTCGTGGGGACTCATCACGGGCTTCAAGTATGTTTCCTCGTCTCCTCACCCTCCTCTCTT
CCCCCCCCCCCTTTTTTTTTGGGCCTCCGCTAAGCAACATGACCATTCTAGGAGCCCCTTCCCGTGGTTCTACCC
CGTCTTCTTCTGCTGCATGATTACCCACCGCGCCTGGCGCGACATTCATCGCTGCCGCATCAAATACGGCGATGC
CTGGCTAGAGTACGAGCGACGGGTGCCGTACCTCTTCATCCCCGTGAGTCCTCCTTCCCTCAGCAAGTCATCTCT
GCGCTGTGACCAACCTCGTTCCGTGCAGTACGTCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail