Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2744
Gene name
Locationscaffold_220:3763..9194
Strand-
Gene length (bp)5431
Transcript length (bp)5355
Coding sequence length (bp)5352
Protein length (aa) 1784

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00614 PLDc Phospholipase D Active site motif 1.8E-08 900 926
PF00614 PLDc Phospholipase D Active site motif 1.1E-06 1208 1230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 346 1302 0.0E+00
sp|P36126|SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO14 PE=1 SV=3 615 1291 0.0E+00
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2 SV=1 595 1277 1.0E-133
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE=1 SV=2 595 1268 6.0E-133
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE=1 SV=2 595 1277 1.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 346 1302 0.0E+00
sp|P36126|SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO14 PE=1 SV=3 615 1291 0.0E+00
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2 SV=1 595 1277 1.0E-133
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE=1 SV=2 595 1268 6.0E-133
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE=1 SV=2 595 1277 1.0E-132
sp|P70498|PLD2_RAT Phospholipase D2 OS=Rattus norvegicus GN=Pld2 PE=1 SV=2 595 1277 9.0E-131
sp|Q9M9W8|PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana GN=PLPZETA2 PE=1 SV=2 590 1283 5.0E-108
sp|Q54UK0|PLDA_DICDI Phospholipase D A OS=Dictyostelium discoideum GN=pldA PE=2 SV=1 785 1278 7.0E-93
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 955 1282 2.0E-78
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 955 1281 3.0E-77
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 955 1281 1.0E-76
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 955 1277 2.0E-76
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 583 1032 4.0E-64
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 1039 1285 3.0E-60
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 1050 1283 5.0E-56
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 590 936 5.0E-52
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 600 936 1.0E-51
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 600 936 9.0E-50
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 600 936 6.0E-49
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 792 1017 9.0E-47
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 1048 1278 1.0E-45
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 779 1044 5.0E-44
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 1048 1338 8.0E-44
sp|P93733|PLDB1_ARATH Phospholipase D beta 1 OS=Arabidopsis thaliana GN=PLDBETA1 PE=1 SV=4 808 1294 3.0E-39
sp|O23078|PLDB2_ARATH Phospholipase D beta 2 OS=Arabidopsis thaliana GN=PLDBETA2 PE=2 SV=3 807 1287 1.0E-38
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 779 1039 9.0E-38
sp|Q43270|PLDA1_MAIZE Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 SV=1 795 1285 2.0E-36
sp|Q43007|PLDA1_ORYSJ Phospholipase D alpha 1 OS=Oryza sativa subsp. japonica GN=PLD1 PE=1 SV=2 795 1285 5.0E-35
sp|Q9SSQ9|PLDA2_ARATH Phospholipase D alpha 2 OS=Arabidopsis thaliana GN=PLDALPHA2 PE=2 SV=1 795 1294 5.0E-35
sp|Q70EW5|PLDA1_CYNCA Phospholipase D alpha 1 OS=Cynara cardunculus GN=PLD1 PE=1 SV=2 804 1285 6.0E-35
sp|P86387|PLDA1_CARPA Phospholipase D alpha 1 OS=Carica papaya GN=PLD1 PE=1 SV=1 804 1287 7.0E-35
sp|O04865|PLDA1_VIGUN Phospholipase D alpha 1 OS=Vigna unguiculata GN=PLD1 PE=2 SV=1 795 1294 2.0E-34
sp|Q9C5Y0|PLDD1_ARATH Phospholipase D delta OS=Arabidopsis thaliana GN=PLDDELTA PE=1 SV=2 804 1285 3.0E-34
sp|Q41142|PLDA1_RICCO Phospholipase D alpha 1 OS=Ricinus communis GN=PLD1 PE=1 SV=1 804 1290 5.0E-34
sp|O82549|PLDA1_BRAOC Phospholipase D alpha 1 OS=Brassica oleracea var. capitata GN=PLD1 PE=2 SV=1 795 1278 7.0E-34
sp|Q38882|PLDA1_ARATH Phospholipase D alpha 1 OS=Arabidopsis thaliana GN=PLDALPHA1 PE=1 SV=2 795 1278 7.0E-34
sp|Q9T052|PLDG3_ARATH Phospholipase D gamma 3 OS=Arabidopsis thaliana GN=PLDGAMMA3 PE=1 SV=1 804 1294 1.0E-33
sp|Q9T053|PLDG1_ARATH Phospholipase D gamma 1 OS=Arabidopsis thaliana GN=PLDGAMMA1 PE=1 SV=1 804 1294 2.0E-33
sp|P93400|PLDA1_TOBAC Phospholipase D alpha 1 OS=Nicotiana tabacum GN=PLD1 PE=2 SV=2 804 1290 2.0E-33
sp|P55939|PLDA2_BRAOC Phospholipase D alpha 2 OS=Brassica oleracea var. capitata GN=PLD2 PE=1 SV=2 795 1278 7.0E-33
sp|Q9T051|PLDG2_ARATH Phospholipase D gamma 2 OS=Arabidopsis thaliana GN=PLDGAMMA2 PE=1 SV=3 804 1294 4.0E-32
sp|P93844|PLDA2_ORYSJ Phospholipase D alpha 2 OS=Oryza sativa subsp. japonica GN=PLD2 PE=2 SV=2 804 1294 9.0E-32
sp|P58766|PLDA3_ARATH Phospholipase D alpha 3 OS=Arabidopsis thaliana GN=PLDALPHA3 PE=2 SV=1 900 1276 4.0E-31
sp|Q9C888|PLDA4_ARATH Phospholipase D alpha 4 OS=Arabidopsis thaliana GN=PLDALPHA4 PE=2 SV=1 797 1287 2.0E-30
sp|O04883|PLDA1_PIMBR Phospholipase D alpha 1 OS=Pimpinella brachycarpa GN=PLD1 PE=2 SV=1 804 1284 2.0E-26
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 1482 1597 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2744
MAGDDDGSVSPGTRNPRPPADASSQPPPHASPPPRSDSLSPRHDEAKDYWNGGLKHHDISPKITPDGSGMRFANV
VAHEPEEPPSPLGSHPSSPDVVAVSGRRSVQFARPDVPETSNASTTGSHAQHARHSSWDPPDAPARSRSASFMSK
IRAFASNPNLQTTKVQGAASTPMENASPSLPNSPNANRLGSRLPDTLAEEQSDADADIEETADEATVPEPGPPKK
KKKRKMRRFKKGQLSPSTPNGRPSEADTIDTYSRLLRRRASMPDTSIHANILSDGDGREQQSRRRPFRRGHSYAE
AAPREPGDDNEEAVASRSGHLRRITVFGGGGVSDGDAMSPRRPFFTSERASNFGAQKWKQVKSTLKLLRQRKEDR
FDYYKSAELMAELRAGAPAVLMLASMIQRDEHGNKRIPVLLEQLKVRVKDSCPIPDDDRERHWIFTFELEYGSGP
SRMSWTVIRNIRDIYNLHFRYKFALGNDKYMPGRSDMGARPRQPKFPYSAFPYLRRARIKGDDSEDEDQASARGE
ETAGEGTAGEGTAGEGATDEGQPQPRRRKSRANLWGMRRRSTGFTDPGEVSNAEAAQSNAALDMMNRRQRYVEKQ
RRTLEKYLAEMIRWLMFRADSNRLCRFLELSALGVRLAAEGSYHGKEGFLHIQSSKGLDFRRVLTPAKVIARHSR
KWFLVRQSYIVCVESPENMNIYDVYLVDSKFSIVSKRNPLKKMGSRQADIDLTVDVPREKHHTLTLCTSERKVRL
FSSYQSVMRQFEESINEMLRQTPWYDKKRFGSFAPVRTGVHAQWLVDGRDYMWNVSRAINMARDVIYIHDWWLSP
ELYTRRPACISQKWRLDRLLQRKAREGVKIFIIIYRNVEAAIPIDSEYTKSSLLNLHPNIFVQRSPNQFKKNQFF
FAHHEKILIVDHDVAFLGGIDLCFGRWDCPQHPIVDDKPTGFETSERPKDAEHCQLFPGKDYSNPRVQDFFRLSE
PYEEMYDRSKVPRMPWHDVGMQVVGQPARDLTRHFVQRWNYLRRGRKPTRPLPFLLPPPDARLDELDNLGLTGTC
EVQILRSAATWSLGIEETEHSIQTAYVRMIEESQHFIYMENQFFITSTEAYNTKIVNRIGDALVDRIIRARDNGE
NWRCAIVIPLMPGFQNTVDEQEGTSVRLIVMCQYRSICRGEHSIFGRLRAAGIDPEEYIGFYSLRQWGVMGNDAL
VTEQLYIHAKTIIVDDRVALIGSANINERSMLGTRDSECAAMVRDTDMIWSRMAGKPYQVGRFAHTLRLRLMREH
LGLDVDDILEEERQQEMDRDAFDREMEQIYGDRPPSPAVAGPSTERGRPLSTQPAMPRLPSFNHDADAEAAPDFD
DTSYKGKETWTDSRVMGRKHQLDVSGYGLDHWKSAEEAGIDGGRDSVIVNGREVLVQSVDSQGKGALDSPRSADD
HMSAADRRRRHESPGASEGMPPIPPLDRRATEQLELPRAAQLPPLPVMDDTDIGGPPVHIDPLTGRPTHGVFHPM
AADIHAADISKDCMRDPVDPSFMDEVWNRAAKNNTKLYRRVFRCMPDSEVSTWAEYREYMEYGERLRATMEGKAM
GESSELKNETSHAKEPTAGGAGISAPGPEVMGKVVRKEMRKASDKLSEKMPGPDGEKTRTAEGGEAPASEKPPPR
SAGSEPLLSATHGGPETPTVALSQGGTPLAHATFPALENGTSKERKATFSPVDNVPFKEAGQPGSIKRRRRATTK
GSKRGLSMEEMPSRSDAEELLKMIQGNLVQFPYDWLLTEEQNGNWGYQVDGVAPLAIYD
Coding >Ophio5|2744
ATGGCTGGAGACGACGACGGGTCTGTGTCGCCTGGCACGCGGAATCCCCGGCCGCCTGCCGACGCCAGCTCTCAG
CCACCACCACATGCGTCACCGCCCCCCCGTTCTGACAGCCTCTCCCCTCGCCATGACGAGGCCAAAGACTACTGG
AACGGCGGGCTGAAGCACCATGATATCTCGCCAAAGATCACCCCCGACGGCTCCGGAATGCGCTTTGCCAATGTC
GTCGCCCACGAACCTGAAGAGCCTCCATCTCCCCTCGGGTCGCACCCCAGCTCACCCGACGTCGTGGCCGTCTCG
GGCAGACGGAGCGTTCAGTTTGCGAGGCCAGACGTGCCGGAGACGTCTAACGCTTCCACTACAGGCTCCCACGCC
CAACACGCCCGCCACAGCTCCTGGGATCCCCCAGACGCTCCTGCAAGGTCCCGGAGCGCCTCCTTCATGTCCAAG
ATCAGGGCTTTTGCGAGCAACCCCAACCTCCAGACGACCAAGGTGCAGGGCGCAGCCTCGACGCCCATGGAAAAC
GCCTCGCCCTCGCTGCCCAACTCACCCAACGCAAACCGCCTTGGCTCCCGACTTCCGGACACGCTCGCCGAGGAG
CAGTCCGATGCCGACGCAGACATCGAGGAGACGGCCGACGAGGCGACCGTTCCGGAACCAGGGCCCCCGAAAAAG
AAGAAGAAGCGCAAGATGCGTCGGTTCAAAAAGGGGCAGTTGTCGCCCTCGACGCCCAATGGCCGGCCGAGCGAG
GCCGACACCATAGACACATATAGCCGGTTGCTGAGGCGCCGCGCCAGCATGCCCGACACGTCGATTCATGCCAAC
ATCTTGTCGGACGGAGATGGGCGCGAGCAACAGTCGAGGCGCAGGCCTTTCAGGAGAGGTCACTCGTACGCCGAG
GCCGCCCCGAGGGAGCCTGGCGACGACAACGAAGAGGCCGTCGCATCGAGATCGGGCCACCTGCGGCGAATCACC
GTCTTCGGTGGAGGCGGCGTGTCGGACGGTGACGCCATGTCTCCCAGGCGGCCATTCTTCACCTCGGAGCGAGCC
TCGAACTTTGGCGCCCAGAAATGGAAACAGGTCAAGAGTACGCTGAAGCTGCTGCGGCAGAGAAAGGAAGACCGC
TTCGACTACTACAAGTCGGCGGAGCTCATGGCTGAGCTGAGGGCCGGCGCGCCCGCCGTCCTAATGTTGGCGAGC
ATGATCCAGCGGGACGAGCATGGGAATAAGAGGATCCCTGTGCTCCTGGAGCAGCTCAAGGTCAGGGTCAAGGAC
AGCTGTCCGATCCCGGACGACGACCGGGAGCGGCACTGGATATTCACCTTTGAGCTCGAGTACGGCAGCGGGCCC
AGCCGGATGAGCTGGACCGTCATTCGCAACATCCGCGACATTTATAACCTACACTTTCGCTACAAGTTTGCCCTC
GGCAACGACAAGTATATGCCCGGCCGCTCCGATATGGGAGCCCGTCCGAGGCAGCCCAAGTTCCCCTACTCGGCG
TTCCCCTACTTGCGACGTGCCCGCATCAAGGGCGACGATAGCGAGGACGAGGACCAGGCCAGCGCTCGCGGGGAA
GAGACGGCCGGCGAGGGGACGGCCGGCGAGGGGACGGCCGGCGAGGGGGCCACCGACGAAGGCCAGCCGCAGCCG
CGACGTAGGAAGTCGCGAGCCAACCTCTGGGGGATGCGGCGCCGTTCGACCGGCTTTACCGACCCGGGCGAAGTC
TCCAACGCCGAGGCCGCTCAGTCGAACGCGGCGCTGGACATGATGAACCGGAGGCAGCGCTACGTCGAGAAGCAG
AGACGGACTCTGGAAAAGTATCTCGCCGAGATGATACGCTGGCTCATGTTCCGAGCCGACAGCAACCGCCTCTGC
CGCTTCCTCGAGCTGTCCGCGCTGGGCGTGCGTCTCGCGGCCGAGGGCAGCTATCACGGCAAGGAGGGCTTTTTG
CACATACAGTCGTCCAAGGGGCTGGACTTCCGCCGCGTCCTGACGCCGGCAAAGGTCATTGCCCGTCACAGCCGC
AAGTGGTTCCTCGTCCGACAAAGCTACATCGTGTGCGTCGAGTCGCCCGAGAACATGAACATCTACGACGTCTAC
TTGGTCGACTCCAAGTTCAGCATCGTGTCCAAGCGCAACCCGCTTAAGAAGATGGGCTCCAGGCAGGCCGACATC
GACCTGACGGTGGATGTGCCGCGGGAGAAGCACCACACGCTGACGCTGTGCACGTCAGAGCGCAAGGTCCGCCTG
TTCTCCAGCTACCAGTCTGTCATGCGTCAGTTCGAGGAGTCCATCAACGAGATGCTCAGGCAGACGCCGTGGTAC
GACAAGAAACGGTTCGGGAGCTTCGCCCCGGTGCGCACCGGCGTCCACGCCCAGTGGCTCGTCGACGGCCGGGAC
TACATGTGGAACGTATCCAGGGCCATTAACATGGCCCGAGACGTCATCTACATCCACGACTGGTGGCTGAGCCCC
GAGCTGTACACGCGGAGGCCTGCGTGCATCAGCCAGAAGTGGCGTCTCGACCGGCTGCTGCAGAGAAAGGCCCGC
GAGGGCGTCAAGATCTTCATCATCATCTACCGCAACGTCGAAGCGGCCATCCCCATCGACTCCGAGTACACAAAG
TCGTCGTTGCTTAACCTGCATCCGAACATCTTTGTCCAACGGTCTCCCAACCAGTTCAAGAAGAATCAGTTCTTC
TTCGCGCACCACGAGAAGATCCTCATCGTGGACCACGACGTCGCCTTCTTGGGCGGCATCGACCTCTGCTTCGGC
CGCTGGGACTGTCCACAGCATCCCATCGTCGACGACAAGCCGACGGGATTCGAGACGTCGGAGCGGCCCAAGGAC
GCCGAGCACTGCCAGCTGTTCCCCGGCAAGGACTACTCAAACCCCAGGGTCCAGGACTTCTTCAGGCTCAGCGAG
CCCTACGAGGAGATGTACGACCGTAGCAAGGTCCCCCGCATGCCCTGGCACGACGTGGGCATGCAGGTCGTCGGC
CAGCCGGCCCGTGACCTGACGCGACACTTCGTCCAGCGCTGGAACTATCTCCGTCGCGGGCGCAAGCCGACACGG
CCCCTGCCCTTCCTGCTGCCGCCTCCGGATGCCAGGCTGGACGAGTTGGACAACCTCGGCCTGACGGGCACTTGT
GAGGTGCAAATTCTACGCTCGGCGGCCACTTGGTCGCTTGGCATTGAGGAGACGGAACATAGCATCCAGACGGCG
TACGTCAGGATGATTGAAGAGTCGCAGCATTTCATCTACATGGAGAATCAGTTCTTCATCACCAGCACCGAGGCT
TACAACACCAAGATTGTCAACCGCATCGGGGACGCCCTCGTGGACCGCATCATCCGCGCGCGCGACAACGGCGAG
AACTGGCGCTGCGCCATCGTCATCCCCCTGATGCCCGGATTTCAAAACACCGTGGACGAGCAGGAGGGAACCAGC
GTCCGGCTCATCGTCATGTGCCAGTATCGAAGCATCTGCCGAGGGGAGCACTCGATATTCGGCCGTCTGCGGGCG
GCGGGCATCGACCCTGAGGAGTACATTGGCTTCTACTCGCTGCGGCAGTGGGGGGTCATGGGCAACGACGCCCTC
GTGACGGAGCAGCTGTACATCCACGCCAAGACCATCATCGTCGACGATCGGGTCGCTCTCATCGGCTCCGCCAAC
ATCAACGAACGGTCCATGCTGGGCACGAGAGACTCGGAATGTGCGGCCATGGTGCGAGACACGGACATGATATGG
TCCAGGATGGCCGGCAAGCCGTACCAGGTCGGTCGCTTCGCTCACACGTTGCGTCTGCGTCTGATGCGGGAGCAT
CTCGGACTCGACGTCGACGATATCTTGGAGGAGGAACGACAGCAGGAAATGGATCGCGACGCCTTTGACCGAGAA
ATGGAGCAGATTTACGGCGACAGGCCGCCGTCGCCAGCCGTCGCCGGTCCCAGCACAGAACGCGGGAGGCCGCTG
AGCACACAGCCGGCGATGCCGCGGCTGCCCAGCTTCAACCACGACGCGGACGCGGAAGCGGCTCCGGACTTTGAT
GACACTTCGTACAAGGGAAAAGAAACATGGACCGATTCTCGGGTCATGGGTAGGAAGCACCAGCTGGACGTGTCA
GGATACGGGCTGGACCACTGGAAGAGCGCCGAGGAGGCGGGCATCGATGGGGGACGTGATTCGGTCATTGTCAAT
GGACGCGAGGTGCTCGTACAAAGCGTCGACAGCCAAGGAAAAGGAGCCTTGGACTCTCCGAGGTCGGCCGACGAC
CACATGTCGGCCGCAGACAGGCGGCGTCGTCATGAGTCTCCCGGGGCCAGCGAAGGGATGCCTCCCATCCCCCCG
CTCGATCGCCGTGCCACGGAGCAGCTGGAGTTGCCGCGAGCGGCTCAGCTTCCCCCTCTGCCCGTCATGGACGAC
ACGGACATCGGGGGGCCGCCCGTCCACATAGACCCCCTGACGGGCCGGCCGACGCACGGCGTCTTTCACCCCATG
GCGGCGGACATCCACGCGGCGGACATAAGCAAGGACTGCATGCGCGACCCGGTGGATCCAAGCTTCATGGATGAG
GTCTGGAACCGCGCGGCCAAGAACAATACAAAGCTCTATCGCAGGGTCTTCCGCTGCATGCCGGACTCCGAGGTG
AGCACGTGGGCCGAGTATCGCGAGTACATGGAGTACGGCGAGAGGCTGCGAGCGACCATGGAGGGCAAGGCCATG
GGCGAATCGAGCGAGCTCAAGAACGAGACGAGTCATGCCAAGGAGCCGACGGCGGGTGGCGCCGGCATCAGCGCT
CCCGGGCCCGAGGTCATGGGCAAGGTCGTCCGAAAAGAGATGCGAAAGGCGTCGGATAAGCTATCGGAGAAGATG
CCGGGTCCGGACGGGGAGAAGACGAGGACAGCCGAGGGCGGAGAGGCGCCGGCGAGCGAGAAGCCCCCCCCGCGC
AGCGCAGGCTCGGAGCCGCTCCTGAGCGCAACGCACGGCGGACCGGAGACGCCGACCGTGGCCCTTTCGCAGGGA
GGCACCCCTTTGGCGCACGCCACCTTTCCTGCGCTGGAGAACGGGACGAGCAAGGAGCGCAAGGCGACCTTTTCG
CCTGTCGACAACGTGCCGTTCAAGGAGGCCGGGCAGCCCGGATCCATCAAGCGCCGGCGCCGTGCCACTACCAAG
GGCAGCAAGCGCGGCCTCTCGATGGAGGAGATGCCTTCACGTTCGGACGCCGAGGAGCTGCTGAAGATGATACAG
GGCAATCTGGTGCAGTTTCCGTACGACTGGCTCCTGACGGAGGAGCAGAACGGAAACTGGGGCTACCAAGTGGAC
GGCGTAGCCCCGCTGGCCATCTATGAT
Transcript >Ophio5|2744
ATGGCTGGAGACGACGACGGGTCTGTGTCGCCTGGCACGCGGAATCCCCGGCCGCCTGCCGACGCCAGCTCTCAG
CCACCACCACATGCGTCACCGCCCCCCCGTTCTGACAGCCTCTCCCCTCGCCATGACGAGGCCAAAGACTACTGG
AACGGCGGGCTGAAGCACCATGATATCTCGCCAAAGATCACCCCCGACGGCTCCGGAATGCGCTTTGCCAATGTC
GTCGCCCACGAACCTGAAGAGCCTCCATCTCCCCTCGGGTCGCACCCCAGCTCACCCGACGTCGTGGCCGTCTCG
GGCAGACGGAGCGTTCAGTTTGCGAGGCCAGACGTGCCGGAGACGTCTAACGCTTCCACTACAGGCTCCCACGCC
CAACACGCCCGCCACAGCTCCTGGGATCCCCCAGACGCTCCTGCAAGGTCCCGGAGCGCCTCCTTCATGTCCAAG
ATCAGGGCTTTTGCGAGCAACCCCAACCTCCAGACGACCAAGGTGCAGGGCGCAGCCTCGACGCCCATGGAAAAC
GCCTCGCCCTCGCTGCCCAACTCACCCAACGCAAACCGCCTTGGCTCCCGACTTCCGGACACGCTCGCCGAGGAG
CAGTCCGATGCCGACGCAGACATCGAGGAGACGGCCGACGAGGCGACCGTTCCGGAACCAGGGCCCCCGAAAAAG
AAGAAGAAGCGCAAGATGCGTCGGTTCAAAAAGGGGCAGTTGTCGCCCTCGACGCCCAATGGCCGGCCGAGCGAG
GCCGACACCATAGACACATATAGCCGGTTGCTGAGGCGCCGCGCCAGCATGCCCGACACGTCGATTCATGCCAAC
ATCTTGTCGGACGGAGATGGGCGCGAGCAACAGTCGAGGCGCAGGCCTTTCAGGAGAGGTCACTCGTACGCCGAG
GCCGCCCCGAGGGAGCCTGGCGACGACAACGAAGAGGCCGTCGCATCGAGATCGGGCCACCTGCGGCGAATCACC
GTCTTCGGTGGAGGCGGCGTGTCGGACGGTGACGCCATGTCTCCCAGGCGGCCATTCTTCACCTCGGAGCGAGCC
TCGAACTTTGGCGCCCAGAAATGGAAACAGGTCAAGAGTACGCTGAAGCTGCTGCGGCAGAGAAAGGAAGACCGC
TTCGACTACTACAAGTCGGCGGAGCTCATGGCTGAGCTGAGGGCCGGCGCGCCCGCCGTCCTAATGTTGGCGAGC
ATGATCCAGCGGGACGAGCATGGGAATAAGAGGATCCCTGTGCTCCTGGAGCAGCTCAAGGTCAGGGTCAAGGAC
AGCTGTCCGATCCCGGACGACGACCGGGAGCGGCACTGGATATTCACCTTTGAGCTCGAGTACGGCAGCGGGCCC
AGCCGGATGAGCTGGACCGTCATTCGCAACATCCGCGACATTTATAACCTACACTTTCGCTACAAGTTTGCCCTC
GGCAACGACAAGTATATGCCCGGCCGCTCCGATATGGGAGCCCGTCCGAGGCAGCCCAAGTTCCCCTACTCGGCG
TTCCCCTACTTGCGACGTGCCCGCATCAAGGGCGACGATAGCGAGGACGAGGACCAGGCCAGCGCTCGCGGGGAA
GAGACGGCCGGCGAGGGGACGGCCGGCGAGGGGACGGCCGGCGAGGGGGCCACCGACGAAGGCCAGCCGCAGCCG
CGACGTAGGAAGTCGCGAGCCAACCTCTGGGGGATGCGGCGCCGTTCGACCGGCTTTACCGACCCGGGCGAAGTC
TCCAACGCCGAGGCCGCTCAGTCGAACGCGGCGCTGGACATGATGAACCGGAGGCAGCGCTACGTCGAGAAGCAG
AGACGGACTCTGGAAAAGTATCTCGCCGAGATGATACGCTGGCTCATGTTCCGAGCCGACAGCAACCGCCTCTGC
CGCTTCCTCGAGCTGTCCGCGCTGGGCGTGCGTCTCGCGGCCGAGGGCAGCTATCACGGCAAGGAGGGCTTTTTG
CACATACAGTCGTCCAAGGGGCTGGACTTCCGCCGCGTCCTGACGCCGGCAAAGGTCATTGCCCGTCACAGCCGC
AAGTGGTTCCTCGTCCGACAAAGCTACATCGTGTGCGTCGAGTCGCCCGAGAACATGAACATCTACGACGTCTAC
TTGGTCGACTCCAAGTTCAGCATCGTGTCCAAGCGCAACCCGCTTAAGAAGATGGGCTCCAGGCAGGCCGACATC
GACCTGACGGTGGATGTGCCGCGGGAGAAGCACCACACGCTGACGCTGTGCACGTCAGAGCGCAAGGTCCGCCTG
TTCTCCAGCTACCAGTCTGTCATGCGTCAGTTCGAGGAGTCCATCAACGAGATGCTCAGGCAGACGCCGTGGTAC
GACAAGAAACGGTTCGGGAGCTTCGCCCCGGTGCGCACCGGCGTCCACGCCCAGTGGCTCGTCGACGGCCGGGAC
TACATGTGGAACGTATCCAGGGCCATTAACATGGCCCGAGACGTCATCTACATCCACGACTGGTGGCTGAGCCCC
GAGCTGTACACGCGGAGGCCTGCGTGCATCAGCCAGAAGTGGCGTCTCGACCGGCTGCTGCAGAGAAAGGCCCGC
GAGGGCGTCAAGATCTTCATCATCATCTACCGCAACGTCGAAGCGGCCATCCCCATCGACTCCGAGTACACAAAG
TCGTCGTTGCTTAACCTGCATCCGAACATCTTTGTCCAACGGTCTCCCAACCAGTTCAAGAAGAATCAGTTCTTC
TTCGCGCACCACGAGAAGATCCTCATCGTGGACCACGACGTCGCCTTCTTGGGCGGCATCGACCTCTGCTTCGGC
CGCTGGGACTGTCCACAGCATCCCATCGTCGACGACAAGCCGACGGGATTCGAGACGTCGGAGCGGCCCAAGGAC
GCCGAGCACTGCCAGCTGTTCCCCGGCAAGGACTACTCAAACCCCAGGGTCCAGGACTTCTTCAGGCTCAGCGAG
CCCTACGAGGAGATGTACGACCGTAGCAAGGTCCCCCGCATGCCCTGGCACGACGTGGGCATGCAGGTCGTCGGC
CAGCCGGCCCGTGACCTGACGCGACACTTCGTCCAGCGCTGGAACTATCTCCGTCGCGGGCGCAAGCCGACACGG
CCCCTGCCCTTCCTGCTGCCGCCTCCGGATGCCAGGCTGGACGAGTTGGACAACCTCGGCCTGACGGGCACTTGT
GAGGTGCAAATTCTACGCTCGGCGGCCACTTGGTCGCTTGGCATTGAGGAGACGGAACATAGCATCCAGACGGCG
TACGTCAGGATGATTGAAGAGTCGCAGCATTTCATCTACATGGAGAATCAGTTCTTCATCACCAGCACCGAGGCT
TACAACACCAAGATTGTCAACCGCATCGGGGACGCCCTCGTGGACCGCATCATCCGCGCGCGCGACAACGGCGAG
AACTGGCGCTGCGCCATCGTCATCCCCCTGATGCCCGGATTTCAAAACACCGTGGACGAGCAGGAGGGAACCAGC
GTCCGGCTCATCGTCATGTGCCAGTATCGAAGCATCTGCCGAGGGGAGCACTCGATATTCGGCCGTCTGCGGGCG
GCGGGCATCGACCCTGAGGAGTACATTGGCTTCTACTCGCTGCGGCAGTGGGGGGTCATGGGCAACGACGCCCTC
GTGACGGAGCAGCTGTACATCCACGCCAAGACCATCATCGTCGACGATCGGGTCGCTCTCATCGGCTCCGCCAAC
ATCAACGAACGGTCCATGCTGGGCACGAGAGACTCGGAATGTGCGGCCATGGTGCGAGACACGGACATGATATGG
TCCAGGATGGCCGGCAAGCCGTACCAGGTCGGTCGCTTCGCTCACACGTTGCGTCTGCGTCTGATGCGGGAGCAT
CTCGGACTCGACGTCGACGATATCTTGGAGGAGGAACGACAGCAGGAAATGGATCGCGACGCCTTTGACCGAGAA
ATGGAGCAGATTTACGGCGACAGGCCGCCGTCGCCAGCCGTCGCCGGTCCCAGCACAGAACGCGGGAGGCCGCTG
AGCACACAGCCGGCGATGCCGCGGCTGCCCAGCTTCAACCACGACGCGGACGCGGAAGCGGCTCCGGACTTTGAT
GACACTTCGTACAAGGGAAAAGAAACATGGACCGATTCTCGGGTCATGGGTAGGAAGCACCAGCTGGACGTGTCA
GGATACGGGCTGGACCACTGGAAGAGCGCCGAGGAGGCGGGCATCGATGGGGGACGTGATTCGGTCATTGTCAAT
GGACGCGAGGTGCTCGTACAAAGCGTCGACAGCCAAGGAAAAGGAGCCTTGGACTCTCCGAGGTCGGCCGACGAC
CACATGTCGGCCGCAGACAGGCGGCGTCGTCATGAGTCTCCCGGGGCCAGCGAAGGGATGCCTCCCATCCCCCCG
CTCGATCGCCGTGCCACGGAGCAGCTGGAGTTGCCGCGAGCGGCTCAGCTTCCCCCTCTGCCCGTCATGGACGAC
ACGGACATCGGGGGGCCGCCCGTCCACATAGACCCCCTGACGGGCCGGCCGACGCACGGCGTCTTTCACCCCATG
GCGGCGGACATCCACGCGGCGGACATAAGCAAGGACTGCATGCGCGACCCGGTGGATCCAAGCTTCATGGATGAG
GTCTGGAACCGCGCGGCCAAGAACAATACAAAGCTCTATCGCAGGGTCTTCCGCTGCATGCCGGACTCCGAGGTG
AGCACGTGGGCCGAGTATCGCGAGTACATGGAGTACGGCGAGAGGCTGCGAGCGACCATGGAGGGCAAGGCCATG
GGCGAATCGAGCGAGCTCAAGAACGAGACGAGTCATGCCAAGGAGCCGACGGCGGGTGGCGCCGGCATCAGCGCT
CCCGGGCCCGAGGTCATGGGCAAGGTCGTCCGAAAAGAGATGCGAAAGGCGTCGGATAAGCTATCGGAGAAGATG
CCGGGTCCGGACGGGGAGAAGACGAGGACAGCCGAGGGCGGAGAGGCGCCGGCGAGCGAGAAGCCCCCCCCGCGC
AGCGCAGGCTCGGAGCCGCTCCTGAGCGCAACGCACGGCGGACCGGAGACGCCGACCGTGGCCCTTTCGCAGGGA
GGCACCCCTTTGGCGCACGCCACCTTTCCTGCGCTGGAGAACGGGACGAGCAAGGAGCGCAAGGCGACCTTTTCG
CCTGTCGACAACGTGCCGTTCAAGGAGGCCGGGCAGCCCGGATCCATCAAGCGCCGGCGCCGTGCCACTACCAAG
GGCAGCAAGCGCGGCCTCTCGATGGAGGAGATGCCTTCACGTTCGGACGCCGAGGAGCTGCTGAAGATGATACAG
GGCAATCTGGTGCAGTTTCCGTACGACTGGCTCCTGACGGAGGAGCAGAACGGAAACTGGGGCTACCAAGTGGAC
GGCGTAGCCCCGCTGGCCATCTATGATTGA
Gene >Ophio5|2744
ATGGCTGGAGACGACGACGGGTCTGTGTCGCCTGGCACGCGGAATCCCCGGCCGCCTGCCGACGCCAGCTCTCAG
CCACCACCACATGCGTCACCGCCCCCCCGTTCTGACAGCCTCTCCCCTCGCCATGACGAGGCCAAAGACTACTGG
AACGGCGGGCTGAAGCACCATGATATCTCGCCAAAGATCACCCCCGACGGCTCCGGAATGCGCTTTGCCAATGTC
GTCGCCCACGAACCTGAAGAGCCTCCATCTCCCCTCGGGTCGCACCCCAGCTCACCCGACGTCGTGGCCGTCTCG
GGCAGACGGAGCGTTCAGTTTGCGAGGCCAGACGTGCCGGAGACGTCTAACGCTTCCACTACAGGCTCCCACGCC
CAACACGCCCGCCACAGCTCCTGGGATCCCCCAGACGCTCCTGCAAGGTCCCGGAGCGCCTCCTTCATGTCCAAG
ATCAGGGCTTTTGCGAGCAACCCCAACCTCCAGACGACCAAGGTGCAGGGCGCAGCCTCGACGCCCATGGAAAAC
GCCTCGCCCTCGCTGCCCAACTCACCCAACGCAAACCGCCTTGGCTCCCGACTTCCGGACACGCTCGCCGAGGAG
CAGTCCGATGCCGACGCAGACATCGAGGAGACGGCCGACGAGGCGACCGTTCCGGAACCAGGGCCCCCGAAAAAG
AAGAAGAAGCGCAAGATGCGTCGGTTCAAAAAGGGGCAGTTGTCGCCCTCGACGCCCAATGGCCGGCCGAGCGAG
GCCGACACCATAGACACATATAGCCGGTTGCTGAGGCGCCGCGCCAGCATGCCCGACACGTCGATTCATGCCAAC
ATCTTGTCGGACGGAGATGGGCGCGAGCAACAGTCGAGGCGCAGGCCTTTCAGGAGAGGTCACTCGTACGCCGAG
GCCGCCCCGAGGGAGCCTGGCGACGACAACGAAGAGGCCGTCGCATCGAGATCGGGCCACCTGCGGCGAATCACC
GTCTTCGGTGGAGGCGGCGTGTCGGACGGTGACGCCATGTCTCCCAGGCGGCCATTCTTCACCTCGGAGCGAGCC
TCGAACTTTGGCGCCCAGAAATGGAAACAGGTCAAGAGTACGCTGAAGCTGCTGCGGCAGAGAAAGGAAGACCGC
TTCGACTACTACAAGTCGGCGGAGCTCATGGCTGAGCTGAGGGCCGGCGCGCCCGCCGTCCTAATGTTGGCGAGC
ATGATCCAGCGGGACGAGCATGGGAATAAGAGGATCCCTGTGCTCCTGGAGCAGCTCAAGGTCAGGGTCAAGGAC
AGCTGTCCGATCCCGGACGACGACCGGGAGCGGCACTGGATATTCACCTTTGAGCTCGAGTACGGCAGCGGGCCC
AGCCGGATGAGCTGGACCGTCATTCGCAACATCCGCGACATTTATAACCTACACTTTCGCTACAAGTTTGCCCTC
GGCAACGACAAGTATATGCCCGGCCGCTCCGATATGGGAGCCCGTCCGAGGCAGCCCAAGTTCCCCTACTCGGCG
TTCCCCTACTTGCGACGTGCCCGCATCAAGGGCGACGATAGCGAGGACGAGGACCAGGCCAGCGCTCGCGGGGAA
GAGACGGCCGGCGAGGGGACGGCCGGCGAGGGGACGGCCGGCGAGGGGGCCACCGACGAAGGCCAGCCGCAGCCG
CGACGTAGGAAGTCGCGAGCCAACCTCTGGGGGATGCGGCGCCGTTCGACCGGCTTTACCGACCCGGGCGAAGTC
TCCAACGCCGAGGCCGCTCAGTCGAACGCGGCGCTGGACATGATGAACCGGAGGCAGCGCTACGTCGAGAAGCAG
AGACGGACTCTGGAAAAGTATCTCGCCGAGATGATACGCTGGCTCATGTTCCGAGCCGACAGCAACCGCCTCTGC
CGCTTCCTCGAGCTGTCCGCGCTGGGCGTGCGTCTCGCGGCCGAGGGCAGCTATCACGGCAAGGAGGGCTTTTTG
CACATACAGTCGTCCAAGGGGCTGGACTTCCGCCGCGTCCTGACGCCGGCAAAGGTCATTGCCCGTCACAGCCGC
AAGTGGTTCCTCGTCCGACAAAGCTACATCGTGTGCGTCGAGTCGCCCGAGAACATGAACATCTACGACGTCTAC
TTGGTCGACTCCAAGTTCAGCATCGTGTCCAAGCGCAACCCGCTTAAGAAGATGGGCTCCAGGCAGGCCGACATC
GACCTGACGGTGGATGTGCCGCGGGAGAAGCACCACACGCTGACGCTGTGCACGTCAGAGCGCAAGGTCCGCCTG
TTCTCCAGCTACCAGTCTGTCATGCGTCAGTTCGAGGAGTCCATCAACGAGATGCTCAGGCAGACGCCGTGGTAC
GACAAGAAACGGTTCGGGAGCTTCGCCCCGGTGCGCACCGGCGTCCACGCCCAGTGGCTCGTCGACGGCCGGGAC
TACATGTGGAACGTATCCAGGGCCATTAACATGGCCCGAGACGTCATCTACATCCACGACTGGTGGCTGAGCCCC
GAGCTGTACACGCGGAGGCCTGCGTGCATCAGCCAGAAGTGGCGTCTCGACCGGCTGCTGCAGAGAAAGGCCCGC
GAGGGCGTCAAGATCTTCATCATCATCTACCGCAACGTCGAAGCGGCCATCCCCATCGACTCCGAGTACACAAAG
TCGTCGTTGCTTAACCTGCATCCGAACATCTTTGTCCAACGGTCTCCCAACCAGTTCAAGAAGAATCAGTTCTTC
TTCGCGCACCACGAGAAGATCCTCATCGTGGACCACGACGTCGCCTTCTTGGGCGGCATCGACCTCTGCTTCGGC
CGCTGGGACTGTCCACAGCATCCCATCGTCGACGACAAGCCGACGGGATTCGAGACGTCGGAGCGGCCCAAGGAC
GCCGAGCACTGCCAGCTGTTCCCCGGCAAGGACTACTCAAACCCCAGGGTCCAGGACTTCTTCAGGCTCAGCGAG
CCCTACGAGGAGATGTACGACCGTAGCAAGGTCCCCCGCATGCCCTGGCACGACGTGGGCATGCAGGTCGTCGGC
CAGCCGGCCCGTGACCTGACGCGACACTTCGTCCAGCGCTGGAACTATCTCCGTCGCGGGCGCAAGCCGACACGG
CCCCTGCCCTTCCTGCTGCCGCCTCCGGATGCCAGGCTGGACGAGTTGGACAACCTCGGCCTGACGGGCACTTGT
GAGGTGCAAATTCTACGCTCGGCGGCCACTTGGTCGCTTGGCATTGAGGAGACGGAACATAGCATCCAGACGGCG
TACGTCAGGATGATTGAAGAGTCGCAGCATTTCATCTACATGGAGAATCAGTTCTTCATCACCAGCACCGAGGCT
TACAACACCAAGATTGTCAACCGCATCGGGGACGCCCTCGTGGACCGCATCATCCGCGCGCGCGACAACGGCGAG
AACTGGCGCTGCGCCATCGTCATCCCCCTGATGCCCGGATTTCAAAACACCGTGGACGAGCAGGAGGGAACCAGC
GTCCGGCTCATCGTCATGTGCCAGTATCGAAGCATCTGCCGAGGGGAGCACTCGATATTCGGCCGTCTGCGGGCG
GCGGGCATCGACCCTGAGGAGTACATTGGCTTCTACTCGCTGCGGCAGTGGGGGGTCATGGGCAACGACGCCCTC
GTGACGGAGCAGCTGTACATCCACGCCAAGACCATCATCGTCGACGATCGGGTCGCTCTCATCGGCTCCGCCAAC
ATCAACGAACGGTCCATGCTGGGCACGAGAGACTCGGAATGTGCGGCCATGGTGCGAGACACGGACATGATATGG
TCCAGGATGGCCGGCAAGCCGTACCAGGTCGGTCGCTTCGCTCACACGTTGCGTCTGCGTCTGATGCGGGAGCAT
CTCGGACTCGACGTCGACGATATCTTGGAGGAGGAACGACAGCAGGAAATGGATCGCGACGCCTTTGACCGAGAA
ATGGAGCAGATTTACGGCGACAGGCCGCCGTCGCCAGCCGTCGCCGGTCCCAGCACAGAACGCGGGAGGCCGCTG
AGCACACAGCCGGCGATGCCGCGGCTGCCCAGCTTCAACCACGACGCGGACGCGGAAGCGGCTCCGGACTTTGAT
GACACTTCGTACAAGGGAAAAGAAACATGGACCGATTCTCGGGTCATGGGTAGGAAGCACCAGCTGGACGTGTCA
GGATACGGGCTGGACCACTGGAAGAGCGCCGAGGAGGCGGGCATCGATGGGGGACGTGATTCGGTCATTGTCAAT
GGACGCGAGGTGCTCGTACAAAGCGTCGACAGCCAAGGAAAAGGAGCCTTGGACTCTCCGAGGTCGGCCGACGAC
CACATGTCGGCCGCAGACAGGCGGCGTCGTCATGAGTCTCCCGGGGCCAGCGAAGGGATGCCTCCCATCCCCCCG
CTCGATCGCCGTGCCACGGAGCAGCTGGAGTTGCCGCGAGCGGCTCAGCTTCCCCCTCTGCCCGTCATGGACGAC
ACGGACATCGGGGGGCCGCCCGTCCACATAGACCCCCTGACGGGCCGGCCGACGCACGGCGTCTTTCACCCCATG
GCGGCGGACATCCACGCGGCGGACATAAGCAAGGACTGCATGCGCGACCCGGTGGATCCAAGCTTCATGGATGAG
GTCTGGAACCGCGCGGCCAAGAACAATACAAAGCTCTATCGCAGGGTCTTCCGCTGCATGCCGGACTCCGAGGTG
AGCACGTGGGCCGAGTATCGCGAGTACATGGAGTACGGCGAGAGGCTGCGAGCGACCATGGAGGGCAAGGCCATG
GGCGAATCGAGCGAGCTCAAGAACGAGACGAGTCATGCCAAGGAGCCGACGGCGGGTGGCGCCGGCATCAGCGCT
CCCGGGCCCGAGGTCATGGGCAAGGTCGTCCGAAAAGAGATGCGAAAGGCGTCGGATAAGCTATCGGAGAAGATG
CCGGGTCCGGACGGGGAGAAGACGAGGACAGCCGAGGGCGGAGAGGCGCCGGCGAGCGAGAAGCCCCCCCCGCGC
AGCGCAGGCTCGGAGCCGCTCCTGAGCGCAACGCACGGCGGACCGGAGACGCCGACCGTGGCCCTTTCGCAGGGA
GGCACCCCTTTGGCGCACGCCACCTTTCCTGCGCTGGAGAACGGGACGAGCAAGGAGCGCAAGGCGACCTTTTCG
CCTGTCGACAACGTGCCGTTCAAGGAGGCCGGGCAGCCCGGATCCATCAAGCGCCGGCGCCGTGCCACTACCAAG
GGCAGCAAGCGCGGCCTCTCGATGGAGGAGATGCCTTCACGTTCGGACGCCGAGGAGCTGCTGAAGATGATACAG
GGCAATCTGGTGCAGTTTCCGTACGACTGGCTCCTGACGGAGGAGCAGAACGGAAACTGGGGCTACCAAGTGGAC
GGCGTAGCCCCGCTGGCCATCTAGTAGGTCGACCGACTTTCCAACGAGACGAGGCGGCAGAAGGCTGACCAAATT
CCCCCCCCCCCCCCCCTTTTACAGTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail