Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2719
Gene name
Locationscaffold_22:15801..17760
Strand-
Gene length (bp)1959
Transcript length (bp)1803
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 9.5E-23 366 559

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9WZ31|CORA_THEMA Magnesium transport protein CorA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=corA PE=1 SV=1 320 559 1.0E-18
sp|O31543|YFJQ_BACSU Putative metal ion transporter YfjQ OS=Bacillus subtilis (strain 168) GN=yfjQ PE=3 SV=1 284 570 1.0E-08

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 509 531 22
2 541 560 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 14.46 6.54 22.38
CcL In ants, during behavior modification 24.89 12.48 37.30
CcD In ants, recently dead 19.91 9.66 30.17

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.033403 yes
SC16a CcD 0.233050 no
CcL CcD 0.390297 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2719
MEDQVQAAAASSSSTPGRLSGTAFPPGRMGSTASTIGHLSPGKKRSPLSDTDLRRSKSRRRGSLGIAAMFRTVDD
CSELLLDDDSAPPGWQPGAEPGYDPELPDGGHASMPTLSARCNITVIDFSPDRMVQRHFDNEAFIAFLEKPQDKW
ATCRWINVNGLSWDVIQAVGSKKGLHKLALEDVMNLRNRTKADWYPSHAYIVLTLLKLVHLVDRSDHSSSSDDAQ
DTDPDPSLLRRLFRRGHRALRRRRDRTRSPTTPDTEPDGVRAAEKGAIDYGSLTTTTTTARSLPRSLHRFHASGS
EARTSLMERESPLGPRNMAVAAEQVSIFLTGDNTAVSFFETSAADVERPIVTRLSTAGTILRASCDASLLVQALL
DAIVDLALPLTTVYSDLLGDLELDVLTAPSIRQSRSLYLCIAEINKMLRFLQPVDGLVNALRDHRSPNRAGRQLG
DPAAESVIVSSVTCTYLGDVLDHCIVICDALQQLKQSSEDLIGLIFNTISATQNESMRQLTTVTIIFLPLTFITG
FFGQNFNNFPELHHGIWYFWACAVPTAVATVLILMHDMIYSWFVRLFRRKRILSLRRARAAPWPKRRRKLSTSRQ
Coding >Ophio5|2719
ATGGAGGACCAAGTCCAAGCGGCGGCAGCGTCGTCGTCGTCTACGCCCGGACGCTTGAGCGGCACCGCTTTCCCC
CCGGGACGCATGGGCAGCACCGCCTCGACAATCGGCCATCTATCACCTGGCAAGAAGCGCAGCCCGCTCTCCGAC
ACGGATCTCCGACGATCCAAGTCCAGGAGAAGAGGGAGCCTCGGGATCGCTGCCATGTTCCGCACCGTCGACGAT
TGCAGTGAGCTGCTGCTGGATGATGATTCCGCTCCGCCGGGCTGGCAGCCTGGTGCTGAACCGGGTTACGATCCT
GAACTGCCGGATGGCGGTCATGCTTCGATGCCGACGCTCAGTGCTCGCTGTAACATCACCGTCATTGACTTTTCG
CCTGATCGCATGGTGCAGCGACATTTCGATAATGAGGCTTTTATCGCCTTTCTCGAGAAGCCGCAGGACAAGTGG
GCTACTTGTAGATGGATCAACGTCAATGGCTTGAGTTGGGATGTCATTCAGGCGGTTGGCTCGAAAAAGGGGCTT
CACAAGCTTGCGCTCGAAGACGTCATGAACTTGCGAAACCGCACCAAAGCAGACTGGTATCCGAGCCACGCCTAC
ATCGTCCTCACCCTCCTCAAGCTCGTCCACCTCGTCGACCGCTCCGACCACAGCTCCAGCTCCGACGACGCCCAA
GACACTGACCCAGACCCAAGCCTCCTCCGACGGCTCTTTCGACGAGGTCATCGCGCTCTCCGCAGACGACGGGAC
CGGACCCGCAGTCCAACCACCCCCGATACCGAGCCCGATGGCGTCCGGGCGGCGGAAAAGGGGGCAATCGATTAC
GGCTCTCTCACGACGACGACGACGACGGCTAGGTCGTTGCCTAGGTCGTTGCATCGCTTTCATGCTTCGGGTAGT
GAGGCCCGTACTTCACTCATGGAGCGCGAGTCGCCTCTCGGGCCCAGAAACATGGCCGTCGCCGCGGAGCAGGTC
TCCATCTTCCTTACCGGCGACAACACGGCCGTCTCCTTCTTCGAGACGTCGGCTGCTGACGTGGAGAGGCCGATC
GTTACGCGTCTGAGTACAGCGGGCACCATTCTTCGCGCATCGTGCGATGCCTCGCTTCTCGTTCAGGCCCTTCTC
GATGCCATCGTCGACCTCGCCTTACCCCTGACGACCGTCTACTCCGACCTCCTGGGCGATCTCGAGCTCGACGTG
CTGACGGCGCCCTCCATCCGGCAGAGTCGATCGCTCTATCTTTGCATCGCCGAGATCAACAAGATGCTACGCTTC
CTCCAGCCCGTCGACGGTCTGGTAAACGCCCTGCGCGATCATCGGTCGCCGAACCGTGCCGGTCGTCAGCTCGGT
GATCCGGCCGCCGAGAGTGTCATCGTCTCCTCTGTCACCTGCACCTATCTGGGCGACGTCCTCGATCACTGCATC
GTCATCTGCGATGCCCTGCAGCAGCTGAAGCAGTCGAGCGAGGATCTCATCGGCCTCATCTTCAACACCATTTCC
GCCACCCAGAACGAGTCGATGCGCCAGCTCACCACCGTCACCATCATCTTCCTGCCCCTGACCTTCATCACCGGC
TTCTTTGGCCAGAACTTCAACAACTTTCCCGAGCTGCACCACGGCATCTGGTACTTCTGGGCCTGTGCCGTGCCG
ACGGCCGTGGCCACCGTGCTGATCCTCATGCACGACATGATATACTCGTGGTTTGTCCGTCTGTTCCGCCGCAAG
AGGATTCTTAGTCTTCGCCGGGCCAGGGCCGCGCCGTGGCCCAAGAGGAGGCGCAAACTCAGCACATCTCGCCAG
Transcript >Ophio5|2719
ATGGAGGACCAAGTCCAAGCGGCGGCAGCGTCGTCGTCGTCTACGCCCGGACGCTTGAGCGGCACCGCTTTCCCC
CCGGGACGCATGGGCAGCACCGCCTCGACAATCGGCCATCTATCACCTGGCAAGAAGCGCAGCCCGCTCTCCGAC
ACGGATCTCCGACGATCCAAGTCCAGGAGAAGAGGGAGCCTCGGGATCGCTGCCATGTTCCGCACCGTCGACGAT
TGCAGTGAGCTGCTGCTGGATGATGATTCCGCTCCGCCGGGCTGGCAGCCTGGTGCTGAACCGGGTTACGATCCT
GAACTGCCGGATGGCGGTCATGCTTCGATGCCGACGCTCAGTGCTCGCTGTAACATCACCGTCATTGACTTTTCG
CCTGATCGCATGGTGCAGCGACATTTCGATAATGAGGCTTTTATCGCCTTTCTCGAGAAGCCGCAGGACAAGTGG
GCTACTTGTAGATGGATCAACGTCAATGGCTTGAGTTGGGATGTCATTCAGGCGGTTGGCTCGAAAAAGGGGCTT
CACAAGCTTGCGCTCGAAGACGTCATGAACTTGCGAAACCGCACCAAAGCAGACTGGTATCCGAGCCACGCCTAC
ATCGTCCTCACCCTCCTCAAGCTCGTCCACCTCGTCGACCGCTCCGACCACAGCTCCAGCTCCGACGACGCCCAA
GACACTGACCCAGACCCAAGCCTCCTCCGACGGCTCTTTCGACGAGGTCATCGCGCTCTCCGCAGACGACGGGAC
CGGACCCGCAGTCCAACCACCCCCGATACCGAGCCCGATGGCGTCCGGGCGGCGGAAAAGGGGGCAATCGATTAC
GGCTCTCTCACGACGACGACGACGACGGCTAGGTCGTTGCCTAGGTCGTTGCATCGCTTTCATGCTTCGGGTAGT
GAGGCCCGTACTTCACTCATGGAGCGCGAGTCGCCTCTCGGGCCCAGAAACATGGCCGTCGCCGCGGAGCAGGTC
TCCATCTTCCTTACCGGCGACAACACGGCCGTCTCCTTCTTCGAGACGTCGGCTGCTGACGTGGAGAGGCCGATC
GTTACGCGTCTGAGTACAGCGGGCACCATTCTTCGCGCATCGTGCGATGCCTCGCTTCTCGTTCAGGCCCTTCTC
GATGCCATCGTCGACCTCGCCTTACCCCTGACGACCGTCTACTCCGACCTCCTGGGCGATCTCGAGCTCGACGTG
CTGACGGCGCCCTCCATCCGGCAGAGTCGATCGCTCTATCTTTGCATCGCCGAGATCAACAAGATGCTACGCTTC
CTCCAGCCCGTCGACGGTCTGGTAAACGCCCTGCGCGATCATCGGTCGCCGAACCGTGCCGGTCGTCAGCTCGGT
GATCCGGCCGCCGAGAGTGTCATCGTCTCCTCTGTCACCTGCACCTATCTGGGCGACGTCCTCGATCACTGCATC
GTCATCTGCGATGCCCTGCAGCAGCTGAAGCAGTCGAGCGAGGATCTCATCGGCCTCATCTTCAACACCATTTCC
GCCACCCAGAACGAGTCGATGCGCCAGCTCACCACCGTCACCATCATCTTCCTGCCCCTGACCTTCATCACCGGC
TTCTTTGGCCAGAACTTCAACAACTTTCCCGAGCTGCACCACGGCATCTGGTACTTCTGGGCCTGTGCCGTGCCG
ACGGCCGTGGCCACCGTGCTGATCCTCATGCACGACATGATATACTCGTGGTTTGTCCGTCTGTTCCGCCGCAAG
AGGATTCTTAGTCTTCGCCGGGCCAGGGCCGCGCCGTGGCCCAAGAGGAGGCGCAAACTCAGCACATCTCGCCAG
TGA
Gene >Ophio5|2719
ATGGAGGACCAAGTCCAAGCGGCGGCAGCGTCGTCGTCGTCTACGCCCGGACGCTTGAGCGGCACCGCTTTCCCC
CCGGGACGCATGGGCAGCACCGCCTCGACAATCGGCCATCTATCACCTGGCAAGAAGCGCAGCCCGCTCTCCGAC
ACGGATCTCCGACGATCCAAGTCCAGGAGAAGAGGGAGCCTCGGGATCGCTGCCATGTTCCGCACCGTCGACGAT
TGCAGTGAGCTGCTGCTGGATGATGATTCCGCTCCGCCGGGCTGGCAGCCTGGTGCTGAACCGGGTTACGATCCT
GAACTGCCGGATGGCGGTCATGCTTCGATGCCGACGCTCAGTGCTCGCTGTAACATCACCGTCATTGACTTTTCG
CCTGATCGCATGGTGCAGCGACATTTCGATAATGAGGCTTTTATCGCCTTTCTCGAGAAGCCGCAGGACAAGTGG
GCTACTTGTAGATGGATCAACGTCAATGGCTTGAGTTGGGATGTCATTCAGGCGGTTGGCTCGAAAAAGGGGCTT
CACAAGCTTGCGCTCGAAGACGTCATGAACTTGCGAAACCGCACCAAAGCAGACTGGTTCGTGCCAAGATGGGAC
CGAAATCGAATCGTCTCTTGTTCTCTAACCAAAAAGAAATATATATTTATATATATATTTACATGGCAGGTATCC
GAGCCACGCCTACATCGTCCTCACCCTCCTCAAGCTCGTCCACCTCGTCGACCGCTCCGACCACAGCTCCAGCTC
CGACGACGCCCAAGACACTGACCCAGACCCAAGCCTCCTCCGACGGCTCTTTCGACGAGGTCATCGCGCTCTCCG
CAGACGACGGGACCGGACCCGCAGTCCAACCACCCCCGATACCGAGCCCGATGGCGTCCGGGCGGCGGAAAAGGG
GGCAATCGATTACGGCTCTCTCACGACGACGACGACGACGGCTAGGTCGTTGCCTAGGTCGTTGCATCGCTTTCA
TGCTTCGGGTAGTGAGGCCCGTACTTCACTCATGGAGCGCGAGTCGCCTCTCGGGCCCAGAAACATGGCCGTCGC
CGCGGAGCAGGTCTCCATCTTCCTTACCGGCGACAACACGGCCGTCTCCTTCTTCGAGACGTCGGCTGCTGACGT
GGAGAGGCCGATCGTTACGCGTCTGAGTACAGCGGGCACCATTCTTCGCGCATCGTGCGATGCCTCGCTTCTCGT
TCAGGCCCTTCTCGATGCCATCGTCGACCTCGCCTTACCCCTGACGACCGTCTACTCCGACCTCCTGGGCGATCT
CGAGCTCGACGTGCTGACGGCGCCCTCCATCCGGCAGAGTCGATCGCTCTATCTTTGCATCGCCGAGATCAACAA
GATGCTACGCTTCCTCCAGCCCGTCGACGGTCTGGTAAACGCCCTGCGCGATCATCGGTCGCCGAACCGTGCCGG
TCGTCAGCTCGGTGATCCGGCCGCCGAGAGTGTCATCGTCTCCTCTGTCACCTGCACCTATCTGGGCGACGTCCT
CGATCACTGCATCGTCATCTGCGATGCCCTGCAGCAGCTGAAGCAGTCGAGCGAGGATCTCATCGGCCTCATCTT
CAACACCATTTCCGCCACCCAGAACGAGTCGATGCGCCAGCTCACCACCGTCACCATCATCTTCCTGCCCCTGAC
CTTCATCACCGGCTTCTTTGGCCAGAACTTCAACAACTTTCCCGAGCTGCACCACGGCATCTGGTACTTGTAAGT
TGACCCTACCCCTGCCCCCTGCCCTCCATCTCTTCTCGGTCCCTGACCCCCTGACCCCCTAGCTGGGCCTGTGCC
GTGCCGACGGCCGTGGCCACCGTGCTGATCCTCATGCACGACATGATATACTCGTGGTTTGTCCGTCTGTTCCGC
CGCAAGAGGATTCTTAGTCTTCGCCGGGCCAGGGCCGCGCCGTGGCCCAAGAGGAGGCGCAAACTCAGCACATCT
CGCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail