Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2715
Gene name
Locationscaffold_22:7573..9047
Strand-
Gene length (bp)1474
Transcript length (bp)1350
Coding sequence length (bp)1347
Protein length (aa) 449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02537 CRCB CrcB-like protein, Camphor Resistance (CrcB) 1.5E-12 105 214
PF02537 CRCB CrcB-like protein, Camphor Resistance (CrcB) 3.0E-22 312 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTS8|YI7B_SCHPO UPF0695 membrane protein C977.11/PB8B6.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.11 PE=3 SV=1 99 443 5.0E-38
sp|Q08913|YO390_YEAST UPF0695 membrane protein YOR390W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR390W PE=3 SV=1 94 423 3.0E-21
sp|Q08991|YP279_YEAST UPF0695 membrane protein YPL279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL279C PE=3 SV=1 94 423 8.0E-21
sp|Q71XT1|CRCB2_LISMF Putative fluoride ion transporter CrcB 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=crcB2 PE=3 SV=1 312 424 3.0E-07
sp|B0VEC3|CRCB_ACIBY Putative fluoride ion transporter CrcB OS=Acinetobacter baumannii (strain AYE) GN=crcB PE=3 SV=1 320 404 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTS8|YI7B_SCHPO UPF0695 membrane protein C977.11/PB8B6.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.11 PE=3 SV=1 99 443 5.0E-38
sp|Q08913|YO390_YEAST UPF0695 membrane protein YOR390W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR390W PE=3 SV=1 94 423 3.0E-21
sp|Q08991|YP279_YEAST UPF0695 membrane protein YPL279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL279C PE=3 SV=1 94 423 8.0E-21
sp|Q71XT1|CRCB2_LISMF Putative fluoride ion transporter CrcB 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=crcB2 PE=3 SV=1 312 424 3.0E-07
sp|B0VEC3|CRCB_ACIBY Putative fluoride ion transporter CrcB OS=Acinetobacter baumannii (strain AYE) GN=crcB PE=3 SV=1 320 404 4.0E-07
sp|B7I4B4|CRCB_ACIB5 Putative fluoride ion transporter CrcB OS=Acinetobacter baumannii (strain AB0057) GN=crcB PE=3 SV=1 320 404 4.0E-07
sp|B7H0W5|CRCB_ACIB3 Putative fluoride ion transporter CrcB OS=Acinetobacter baumannii (strain AB307-0294) GN=crcB PE=3 SV=1 320 404 4.0E-07
sp|A3M1Q4|CRCB_ACIBT Putative fluoride ion transporter CrcB OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=crcB PE=3 SV=2 320 404 4.0E-07
sp|B0VLD4|CRCB_ACIBS Putative fluoride ion transporter CrcB OS=Acinetobacter baumannii (strain SDF) GN=crcB PE=3 SV=1 320 404 4.0E-07
sp|Q6FF10|CRCB_ACIAD Putative fluoride ion transporter CrcB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=crcB PE=3 SV=1 318 418 2.0E-06
sp|B2I2S5|CRCB_ACIBC Putative fluoride ion transporter CrcB OS=Acinetobacter baumannii (strain ACICU) GN=crcB PE=3 SV=1 320 404 3.0E-06
sp|Q8Y5I0|CRCB2_LISMO Putative fluoride ion transporter CrcB 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=crcB2 PE=3 SV=1 312 437 5.0E-06
sp|P61386|CRCB1_BACC1 Putative fluoride ion transporter CrcB 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=crcB1 PE=3 SV=1 320 417 5.0E-06
sp|Q815R6|CRCB1_BACCR Putative fluoride ion transporter CrcB 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=crcB1 PE=3 SV=1 320 417 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 95 117 22
2 127 149 22
3 182 204 22
4 236 258 22
5 284 306 22
6 310 332 22
7 339 358 19
8 373 395 22
9 402 424 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2715
MSLSPRPEGDFGEGGSERTQVAHPDTPLDEPWTNTNELATSRPIEASPDSRADSPEATRRRQRELRPKSADRPPL
GEDDGDTEAPRPTRGVLSQLATRLYTLSYLVFFSLFGTLARLGLTALTRFPGAPVIFSSVWANFAGCVVMGFLAE
DRRIFQHELGASAPDSLPGREAAKAHQAAKKTIPLYIGLSTGFCGSFTSFSSFMRDVFLAMTDHLYRPVTAEVRI
PGGENRSSGRAFMALVAVVIVTLSLSLSGLFVGAHVALAAERVLPSLPQPTTRRFVDPVGVFLGWGCWLGAILLC
ALPPHQNWRGVLFALVFAPLGTLLRFYLALWLNGRRPSFPLGTWTANMLGTAVLGMAWDIAHVPIGGVVGCQVLT
GISDGFCGCLTTVSTWVAELSSLRRRHAWVYGGASVLVAFVLLVLIMGRGKEEEKEGEEREGKGERERERERLQ
Coding >Ophio5|2715
ATGAGTCTCTCCCCTCGACCCGAAGGCGACTTTGGCGAGGGCGGAAGCGAACGCACCCAAGTCGCCCACCCAGAC
ACTCCCCTCGACGAACCATGGACCAACACAAATGAGCTCGCAACCTCCCGCCCCATAGAAGCCTCCCCGGACTCT
CGCGCCGACAGCCCCGAAGCGACGCGCCGCCGACAGCGAGAGCTGCGTCCCAAATCCGCAGACCGGCCACCACTA
GGCGAAGATGACGGCGATACCGAGGCGCCGCGGCCAACAAGGGGAGTGCTATCACAGCTTGCCACACGGCTGTAC
ACGCTCTCCTATCTCGTATTCTTCTCGCTATTCGGCACCCTCGCGCGTCTTGGTCTGACGGCGTTGACGCGCTTT
CCAGGCGCGCCTGTCATCTTCAGCTCCGTCTGGGCCAACTTTGCCGGCTGTGTCGTCATGGGCTTTCTGGCCGAG
GATCGGCGCATCTTTCAGCATGAGTTGGGGGCGTCGGCGCCTGATTCTTTGCCAGGAAGGGAGGCTGCCAAGGCT
CACCAGGCGGCAAAGAAGACGATTCCGCTATACATTGGCCTGTCTACGGGCTTTTGCGGCAGTTTCACTAGCTTC
TCGTCCTTTATGCGCGACGTCTTCCTCGCCATGACGGATCATCTCTACCGGCCTGTTACGGCCGAGGTGCGCATC
CCCGGCGGCGAGAATCGCAGCAGCGGGAGAGCTTTTATGGCCTTGGTGGCTGTCGTCATCGTCACCTTGTCGCTT
TCCCTATCTGGATTATTCGTCGGCGCGCACGTAGCTCTGGCAGCGGAGCGGGTGCTGCCTTCGTTGCCTCAGCCG
ACGACACGGCGCTTCGTCGATCCGGTTGGTGTCTTTCTCGGCTGGGGATGCTGGCTAGGCGCCATTCTTCTCTGC
GCTTTGCCACCGCACCAAAACTGGCGCGGCGTGCTCTTCGCTCTCGTTTTCGCGCCGTTGGGTACGCTGCTGCGC
TTCTACCTCGCCCTGTGGCTCAACGGGCGCCGACCGTCCTTTCCCCTGGGCACCTGGACGGCCAACATGCTCGGC
ACTGCGGTGCTGGGTATGGCGTGGGATATTGCACATGTGCCCATCGGTGGTGTTGTCGGCTGTCAGGTGCTGACG
GGCATTAGCGATGGCTTCTGCGGCTGTCTGACGACGGTGTCAACTTGGGTGGCGGAGCTGAGTAGCTTGCGAAGG
AGGCATGCTTGGGTGTATGGAGGTGCGAGTGTCTTGGTGGCGTTTGTGCTGCTGGTGCTCATCATGGGAAGGGGG
AAGGAAGAGGAGAAGGAAGGGGAAGAAAGAGAGGGAAAAGGAGAGAGAGAGAGAGAGAGAGAGAGACTTCAG
Transcript >Ophio5|2715
ATGAGTCTCTCCCCTCGACCCGAAGGCGACTTTGGCGAGGGCGGAAGCGAACGCACCCAAGTCGCCCACCCAGAC
ACTCCCCTCGACGAACCATGGACCAACACAAATGAGCTCGCAACCTCCCGCCCCATAGAAGCCTCCCCGGACTCT
CGCGCCGACAGCCCCGAAGCGACGCGCCGCCGACAGCGAGAGCTGCGTCCCAAATCCGCAGACCGGCCACCACTA
GGCGAAGATGACGGCGATACCGAGGCGCCGCGGCCAACAAGGGGAGTGCTATCACAGCTTGCCACACGGCTGTAC
ACGCTCTCCTATCTCGTATTCTTCTCGCTATTCGGCACCCTCGCGCGTCTTGGTCTGACGGCGTTGACGCGCTTT
CCAGGCGCGCCTGTCATCTTCAGCTCCGTCTGGGCCAACTTTGCCGGCTGTGTCGTCATGGGCTTTCTGGCCGAG
GATCGGCGCATCTTTCAGCATGAGTTGGGGGCGTCGGCGCCTGATTCTTTGCCAGGAAGGGAGGCTGCCAAGGCT
CACCAGGCGGCAAAGAAGACGATTCCGCTATACATTGGCCTGTCTACGGGCTTTTGCGGCAGTTTCACTAGCTTC
TCGTCCTTTATGCGCGACGTCTTCCTCGCCATGACGGATCATCTCTACCGGCCTGTTACGGCCGAGGTGCGCATC
CCCGGCGGCGAGAATCGCAGCAGCGGGAGAGCTTTTATGGCCTTGGTGGCTGTCGTCATCGTCACCTTGTCGCTT
TCCCTATCTGGATTATTCGTCGGCGCGCACGTAGCTCTGGCAGCGGAGCGGGTGCTGCCTTCGTTGCCTCAGCCG
ACGACACGGCGCTTCGTCGATCCGGTTGGTGTCTTTCTCGGCTGGGGATGCTGGCTAGGCGCCATTCTTCTCTGC
GCTTTGCCACCGCACCAAAACTGGCGCGGCGTGCTCTTCGCTCTCGTTTTCGCGCCGTTGGGTACGCTGCTGCGC
TTCTACCTCGCCCTGTGGCTCAACGGGCGCCGACCGTCCTTTCCCCTGGGCACCTGGACGGCCAACATGCTCGGC
ACTGCGGTGCTGGGTATGGCGTGGGATATTGCACATGTGCCCATCGGTGGTGTTGTCGGCTGTCAGGTGCTGACG
GGCATTAGCGATGGCTTCTGCGGCTGTCTGACGACGGTGTCAACTTGGGTGGCGGAGCTGAGTAGCTTGCGAAGG
AGGCATGCTTGGGTGTATGGAGGTGCGAGTGTCTTGGTGGCGTTTGTGCTGCTGGTGCTCATCATGGGAAGGGGG
AAGGAAGAGGAGAAGGAAGGGGAAGAAAGAGAGGGAAAAGGAGAGAGAGAGAGAGAGAGAGAGAGACTTCAGTGA
Gene >Ophio5|2715
ATGAGTCTCTCCCCTCGACCCGAAGGCGACTTTGGCGAGGGCGGAAGCGAACGCACCCAAGTCGCCCACCCAGAC
ACTCCCCTCGACGAACCATGGACCAACACAAATGAGCTCGCAACCTCCCGCCCCATAGAAGCCTCCCCGGACTCT
CGCGCCGACAGCCCCGAAGCGACGCGCCGCCGACAGCGAGAGCTGCGTCCCAAATCCGCAGACCGGCCACCACTA
GGCGAAGATGACGGCGATACCGAGGCGCCGCGGCCAACAAGGGGAGTGCTATCACAGCTTGCCACACGGCTGTAC
ACGCTCTCCTATCTCGTATTCTTCTCGCTATTCGGCACCCTCGCGCGTCTTGGTCTGACGGCGTTGACGCGCTTT
CCAGGCGCGCCTGTCATCTTCAGCTCCGTCTGGGCCAACTTTGCCGGCTGTGTCGTCATGGGCTTTCTGGCCGAG
GATCGGCGCATCTTTCAGCATGAGTTGGGGGCGTCGGCGCCTGATTCTTTGCCAGGAAGGGAGGCTGCCAAGGCT
CACCAGGCGGCAAAGAAGACGATTCCGCTATACATTGGCCTGTCTACGGGCTTTTGCGGCAGTTTCACTAGCTTC
TCGTCCTTTATGCGCGACGTCTTCCTCGCCATGACGGATCATCTCTACCGGCCTGTTACGGCCGAGGTGCGCATC
CCCGGCGGCGAGAATCGCAGCAGCGGGAGAGCTTTTATGGCCTTGGTGGCTGTCGTCATCGTCACCTTGTCGCTT
TCCCTATCTGGATTATTCGTCGGCGCGCACGTAGCTCTGGCAGCGGAGCGGGTGCTGCCTTCGTTGCCTCAGCCG
ACGACACGGCGCTTCGTCGATCCGGTTGGTGTCTTTCTCGGCTGGGGATGCTGGCTAGGCGCCATTCTTCTCTGC
GCTTTGCCACCGCACCAAAACTGGCGCGGCGTGCTCTTCGCTCTCGTTTTCGCGCCGTTGGGTACGCTGCTGCGC
TTCTACCTCGCCCTGTGGCTCAACGGGCGCCGACCGTCCTTTCCCCTGGGCACCTGGACGGCCAACATGCTCGGC
ACTGCGGTGCTGGGTATGGCGTGGGATATTGCACATGTGCCCATCGGTGGTGTTGTCGGCTGTCAGGTGCTGACG
GGCATTAGCGATGGCTTCTGCGGCTGTCTGACGACGGTGTCAACTTGGGTGGCGGAGCTGAGTAGCTTGCGAAGG
AGGCATGCTTGGGTGTATGGAGGTGCGAGTGTCTTGGTGGCGTTTGTGCTGCTGGTGCTCATCATGGGTGGGTTG
CAATGGACGCGTGGTTTTGCCATGCTGGAGTGTCGTTAGGAAGGGGGAAGGAAGAGGAGAAGGAAGGGGAAGAAA
GAGAGGGAAAAGGAGAGAGAGAGAGAGAGAGAGAGAGACTTCAGGTGCCTGCCTATTCATCCTTCCGCCGCTCTG
CCCCCCTTTTTTCCCCCTTCTAACCTTGAGTCTCGTCATGTGGTAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail