Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2709
Gene name
Locationscaffold_219:26925..29774
Strand+
Gene length (bp)2849
Transcript length (bp)2688
Coding sequence length (bp)2685
Protein length (aa) 895

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05786 Cnd2 Condensin complex subunit 2 5.4E-92 20 223
PF05786 Cnd2 Condensin complex subunit 2 4.5E-210 253 885

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7R3|CND2_SCHPO Condensin complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnd2 PE=1 SV=1 11 884 2.0E-116
sp|P38170|CND2_YEAST Condensin complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRN1 PE=1 SV=3 105 883 1.0E-80
sp|Q564K3|CND2_ARATH Condensin complex subunit 2 OS=Arabidopsis thaliana GN=CAPH PE=1 SV=1 108 321 4.0E-29
sp|O13067|CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1 519 886 6.0E-15
sp|O13067|CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1 7 319 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7R3|CND2_SCHPO Condensin complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnd2 PE=1 SV=1 11 884 2.0E-116
sp|P38170|CND2_YEAST Condensin complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRN1 PE=1 SV=3 105 883 1.0E-80
sp|Q564K3|CND2_ARATH Condensin complex subunit 2 OS=Arabidopsis thaliana GN=CAPH PE=1 SV=1 108 321 4.0E-29
sp|O13067|CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1 519 886 6.0E-15
sp|O13067|CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1 7 319 2.0E-13
sp|Q8C156|CND2_MOUSE Condensin complex subunit 2 OS=Mus musculus GN=Ncaph PE=1 SV=1 519 885 4.0E-13
sp|Q8C156|CND2_MOUSE Condensin complex subunit 2 OS=Mus musculus GN=Ncaph PE=1 SV=1 1 319 4.0E-12
sp|Q15003|CND2_HUMAN Condensin complex subunit 2 OS=Homo sapiens GN=NCAPH PE=1 SV=3 3 319 8.0E-11
sp|Q15003|CND2_HUMAN Condensin complex subunit 2 OS=Homo sapiens GN=NCAPH PE=1 SV=3 752 885 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0007076 mitotic chromosome condensation Yes
GO:0000796 condensin complex Yes
GO:0009987 cellular process No
GO:0006996 organelle organization No
GO:0071840 cellular component organization or biogenesis No
GO:0030261 chromosome condensation No
GO:0044815 DNA packaging complex No
GO:0016043 cellular component organization No
GO:0051276 chromosome organization No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:1903047 mitotic cell cycle process No
GO:0008150 biological_process No
GO:0022402 cell cycle process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 223 245 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2709
MPRVAQVPRPGGAATVSIPASPFKSPVKIPLNDDAQEKGQRMNSRKALHERQINQLKAAATPRKPAMRLDNSENA
SPRSTTGGTPRSGEAEDEAITVGGVTPMKRVPILANFEEWMKMATDNKINATNSWNFALIDYFHDMSLLKEGDGV
NFQKASCTLDGCVKIYTNRVDSVATETGKLLSGLADSSNSSKKKNGDEAAETGESDEEVDGEGNVRKKAKKKVSS
FFFLFLVLVLLLLLFFFFFFKPSSSLTTRPQAQRSSEATLAPSFAALQLKKLELEFAVDPLFKKASADFDEGGAR
GLLLNHLMIDSRGRIVFDSSDDSEDAVALDKRKEDGDEEAESDEAADDKTKNKEEEDDDDDDGVAIDLASLSQRF
FPDLSRLDELDVCPSLKQFDLGDASGSMDIPFLKAPEDWRTDQDKEKTGGSTLGDKSGVFCDEDGPAGFDDDDGA
LDMGQDVAFGEGGEAWAREAALDPQMRVYDSGRTGDDDDEENDNDDKAEYVVAMTKPQSADKMHEDILGFFDQAL
RKNWTSAEHWRIRKIKDGAKPAPDAKQRRREKEPFEMDFASALNVDALYTQAASNAAISMAKKDWMSKSRNLLPD
DRHFSSRSLLSLFLKPRARMARRRTHHRMRHDEDDADGDDMDEAFWAKRQRPDEMMMMMATTTTASAALPEGDYD
ANFFQDDGLPFPGADDDDDDDDDGLEFADAREHMSPGVVVFGQAEAVGATALGGGGGGGGGETLFPLTQLSAGAF
GSSLVTQTRRARPDYVQYARKAKKVDVRRLKEEMWKGMGLDKLSEPDATAKQSNRLPTPAESEADGIGIGIGSSS
SNDTTLRFSDVIDGLQSVYPKSVMDDISTSYCFICLLHLANEKGLAIDKTDGLDELLIRRDWSADAVDGP
Coding >Ophio5|2709
ATGCCTCGAGTCGCTCAAGTGCCTCGTCCCGGAGGCGCGGCGACTGTGTCGATACCGGCCTCGCCCTTCAAATCG
CCGGTCAAGATCCCTCTCAACGACGATGCGCAGGAAAAGGGTCAGCGCATGAACTCGCGCAAGGCGCTCCACGAA
AGGCAGATCAACCAACTCAAGGCGGCCGCCACGCCGCGCAAGCCCGCGATGCGCCTCGACAACTCGGAGAATGCG
TCGCCGCGCTCGACGACCGGCGGGACCCCCCGCAGCGGCGAAGCGGAAGACGAGGCCATCACCGTTGGCGGTGTT
ACGCCTATGAAGCGCGTCCCCATCTTGGCCAACTTTGAGGAGTGGATGAAGATGGCGACGGATAACAAGATCAAC
GCTACCAATTCGTGGAACTTTGCCCTCATCGACTACTTTCACGATATGTCGCTGCTCAAGGAGGGCGACGGCGTC
AATTTCCAAAAGGCCAGCTGTACTCTCGACGGCTGCGTCAAGATCTACACCAACAGGGTCGACAGCGTCGCCACC
GAGACGGGCAAGCTGCTGAGTGGCCTCGCCGACAGTAGTAACAGCAGCAAGAAGAAAAATGGGGATGAGGCAGCA
GAAACGGGCGAGAGCGACGAAGAGGTCGACGGCGAGGGAAACGTCAGGAAAAAGGCCAAGAAGAAGGTGAGCTCT
TTCTTTTTCCTCTTTCTCGTCCTTGTCCTCCTCCTCCTCCTCTTCTTCTTCTTCTTCTTCAAGCCATCATCGTCG
CTGACAACTCGCCCACAGGCCCAACGATCGTCCGAGGCCACCTTGGCTCCCTCCTTTGCTGCCCTGCAGCTCAAG
AAGTTGGAGCTCGAGTTCGCCGTCGACCCCCTTTTCAAGAAGGCCTCGGCCGACTTCGACGAGGGCGGCGCTAGG
GGCCTGCTGCTCAACCACCTGATGATTGACTCCCGAGGGCGGATCGTCTTTGACAGCAGCGACGACTCGGAAGAC
GCCGTGGCCCTGGATAAAAGGAAAGAGGATGGTGACGAAGAGGCCGAAAGCGACGAAGCGGCCGACGACAAGACC
AAGAACAAGGAGGAGGAGGACGACGACGACGACGACGGCGTTGCCATTGACCTGGCCTCACTCAGCCAAAGATTC
TTCCCTGACCTATCTCGGCTAGACGAGCTCGATGTGTGCCCATCTCTCAAGCAGTTTGATCTTGGAGACGCCTCG
GGCTCCATGGACATTCCCTTTCTCAAGGCGCCGGAAGACTGGCGGACGGACCAGGACAAGGAAAAGACGGGCGGC
AGCACCTTGGGCGACAAATCCGGCGTCTTCTGCGACGAAGATGGGCCGGCCGGCTTCGACGACGACGACGGCGCC
CTGGACATGGGCCAGGATGTGGCCTTTGGTGAGGGCGGCGAGGCCTGGGCACGAGAAGCGGCTCTGGACCCTCAG
ATGCGCGTCTATGATAGTGGCAGAACGGGCGACGATGACGACGAAGAGAATGACAATGACGACAAGGCCGAATAC
GTGGTGGCCATGACGAAGCCCCAGAGCGCCGACAAGATGCACGAGGACATACTCGGCTTCTTCGACCAGGCGCTG
CGCAAGAACTGGACGAGCGCGGAGCACTGGCGCATCCGCAAGATCAAAGACGGCGCCAAGCCGGCTCCCGACGCA
AAGCAGCGACGGAGGGAAAAGGAGCCGTTCGAGATGGACTTTGCCTCTGCGCTCAACGTCGACGCGCTGTACACG
CAGGCGGCCAGTAACGCGGCCATCAGCATGGCCAAGAAGGATTGGATGTCCAAGTCGCGCAACCTGCTGCCGGAC
GACAGGCATTTCAGCTCCCGCTCGCTGCTCAGTCTGTTTCTGAAGCCGAGGGCGCGAATGGCCCGTCGACGGACC
CATCATCGTATGCGGCACGACGAGGACGATGCCGACGGCGACGACATGGACGAGGCCTTTTGGGCGAAACGCCAG
CGGCCTGACGAGATGATGATGATGATGGCGACGACGACGACGGCGTCGGCGGCGCTTCCCGAGGGTGACTACGAT
GCCAATTTCTTTCAAGACGACGGCCTCCCCTTTCCCGGCGCTGACGACGACGACGACGACGACGACGACGGGCTG
GAGTTTGCCGACGCGCGCGAACACATGTCTCCAGGCGTCGTCGTCTTCGGCCAAGCCGAAGCCGTGGGCGCGACG
GCCCTCGGAGGAGGAGGAGGAGGAGGAGGAGGCGAGACCCTGTTTCCCCTGACGCAGCTCTCGGCCGGCGCCTTT
GGATCGAGCCTCGTGACGCAGACGAGGAGGGCGAGACCAGACTATGTGCAGTATGCGCGCAAGGCCAAGAAGGTG
GACGTGAGGCGGCTCAAGGAGGAGATGTGGAAGGGCATGGGGCTGGATAAGCTGTCTGAACCGGACGCCACGGCC
AAGCAAAGCAACCGCCTCCCGACTCCGGCGGAAAGCGAGGCGGACGGCATCGGCATCGGCATCGGCAGCAGCAGC
AGCAACGACACCACCCTCCGCTTCAGCGACGTCATCGACGGCCTCCAATCCGTCTACCCCAAGTCCGTCATGGAC
GACATCTCGACCTCGTACTGCTTCATCTGCCTGCTCCATCTGGCCAACGAAAAGGGTCTCGCCATCGATAAGACG
GACGGCCTCGATGAGCTCCTCATTCGCCGAGATTGGTCTGCCGATGCCGTCGACGGGCCA
Transcript >Ophio5|2709
ATGCCTCGAGTCGCTCAAGTGCCTCGTCCCGGAGGCGCGGCGACTGTGTCGATACCGGCCTCGCCCTTCAAATCG
CCGGTCAAGATCCCTCTCAACGACGATGCGCAGGAAAAGGGTCAGCGCATGAACTCGCGCAAGGCGCTCCACGAA
AGGCAGATCAACCAACTCAAGGCGGCCGCCACGCCGCGCAAGCCCGCGATGCGCCTCGACAACTCGGAGAATGCG
TCGCCGCGCTCGACGACCGGCGGGACCCCCCGCAGCGGCGAAGCGGAAGACGAGGCCATCACCGTTGGCGGTGTT
ACGCCTATGAAGCGCGTCCCCATCTTGGCCAACTTTGAGGAGTGGATGAAGATGGCGACGGATAACAAGATCAAC
GCTACCAATTCGTGGAACTTTGCCCTCATCGACTACTTTCACGATATGTCGCTGCTCAAGGAGGGCGACGGCGTC
AATTTCCAAAAGGCCAGCTGTACTCTCGACGGCTGCGTCAAGATCTACACCAACAGGGTCGACAGCGTCGCCACC
GAGACGGGCAAGCTGCTGAGTGGCCTCGCCGACAGTAGTAACAGCAGCAAGAAGAAAAATGGGGATGAGGCAGCA
GAAACGGGCGAGAGCGACGAAGAGGTCGACGGCGAGGGAAACGTCAGGAAAAAGGCCAAGAAGAAGGTGAGCTCT
TTCTTTTTCCTCTTTCTCGTCCTTGTCCTCCTCCTCCTCCTCTTCTTCTTCTTCTTCTTCAAGCCATCATCGTCG
CTGACAACTCGCCCACAGGCCCAACGATCGTCCGAGGCCACCTTGGCTCCCTCCTTTGCTGCCCTGCAGCTCAAG
AAGTTGGAGCTCGAGTTCGCCGTCGACCCCCTTTTCAAGAAGGCCTCGGCCGACTTCGACGAGGGCGGCGCTAGG
GGCCTGCTGCTCAACCACCTGATGATTGACTCCCGAGGGCGGATCGTCTTTGACAGCAGCGACGACTCGGAAGAC
GCCGTGGCCCTGGATAAAAGGAAAGAGGATGGTGACGAAGAGGCCGAAAGCGACGAAGCGGCCGACGACAAGACC
AAGAACAAGGAGGAGGAGGACGACGACGACGACGACGGCGTTGCCATTGACCTGGCCTCACTCAGCCAAAGATTC
TTCCCTGACCTATCTCGGCTAGACGAGCTCGATGTGTGCCCATCTCTCAAGCAGTTTGATCTTGGAGACGCCTCG
GGCTCCATGGACATTCCCTTTCTCAAGGCGCCGGAAGACTGGCGGACGGACCAGGACAAGGAAAAGACGGGCGGC
AGCACCTTGGGCGACAAATCCGGCGTCTTCTGCGACGAAGATGGGCCGGCCGGCTTCGACGACGACGACGGCGCC
CTGGACATGGGCCAGGATGTGGCCTTTGGTGAGGGCGGCGAGGCCTGGGCACGAGAAGCGGCTCTGGACCCTCAG
ATGCGCGTCTATGATAGTGGCAGAACGGGCGACGATGACGACGAAGAGAATGACAATGACGACAAGGCCGAATAC
GTGGTGGCCATGACGAAGCCCCAGAGCGCCGACAAGATGCACGAGGACATACTCGGCTTCTTCGACCAGGCGCTG
CGCAAGAACTGGACGAGCGCGGAGCACTGGCGCATCCGCAAGATCAAAGACGGCGCCAAGCCGGCTCCCGACGCA
AAGCAGCGACGGAGGGAAAAGGAGCCGTTCGAGATGGACTTTGCCTCTGCGCTCAACGTCGACGCGCTGTACACG
CAGGCGGCCAGTAACGCGGCCATCAGCATGGCCAAGAAGGATTGGATGTCCAAGTCGCGCAACCTGCTGCCGGAC
GACAGGCATTTCAGCTCCCGCTCGCTGCTCAGTCTGTTTCTGAAGCCGAGGGCGCGAATGGCCCGTCGACGGACC
CATCATCGTATGCGGCACGACGAGGACGATGCCGACGGCGACGACATGGACGAGGCCTTTTGGGCGAAACGCCAG
CGGCCTGACGAGATGATGATGATGATGGCGACGACGACGACGGCGTCGGCGGCGCTTCCCGAGGGTGACTACGAT
GCCAATTTCTTTCAAGACGACGGCCTCCCCTTTCCCGGCGCTGACGACGACGACGACGACGACGACGACGGGCTG
GAGTTTGCCGACGCGCGCGAACACATGTCTCCAGGCGTCGTCGTCTTCGGCCAAGCCGAAGCCGTGGGCGCGACG
GCCCTCGGAGGAGGAGGAGGAGGAGGAGGAGGCGAGACCCTGTTTCCCCTGACGCAGCTCTCGGCCGGCGCCTTT
GGATCGAGCCTCGTGACGCAGACGAGGAGGGCGAGACCAGACTATGTGCAGTATGCGCGCAAGGCCAAGAAGGTG
GACGTGAGGCGGCTCAAGGAGGAGATGTGGAAGGGCATGGGGCTGGATAAGCTGTCTGAACCGGACGCCACGGCC
AAGCAAAGCAACCGCCTCCCGACTCCGGCGGAAAGCGAGGCGGACGGCATCGGCATCGGCATCGGCAGCAGCAGC
AGCAACGACACCACCCTCCGCTTCAGCGACGTCATCGACGGCCTCCAATCCGTCTACCCCAAGTCCGTCATGGAC
GACATCTCGACCTCGTACTGCTTCATCTGCCTGCTCCATCTGGCCAACGAAAAGGGTCTCGCCATCGATAAGACG
GACGGCCTCGATGAGCTCCTCATTCGCCGAGATTGGTCTGCCGATGCCGTCGACGGGCCATGA
Gene >Ophio5|2709
ATGCCTCGAGTCGCTCAAGTGCCTCGTCCCGGAGGCGCGGCGACTGTGTCGATACCGGCCTCGCCCTTCAAATCG
CCGGTCAAGTAAGAAAAAAAGCCGGCCCATTCTGCGGCCGGTCGCGCGCTCACCTAGCGACAGGATCCCTCTCAA
CGACGATGCGCAGGAAAAGGGTCAGCGCATGAACTCGCGCAAGGCGCTCCACGAAAGGCAGATCAACCAACTCAA
GGCGGCCGCCACGCCGCGCAAGCCCGCGATGCGCCTCGACAACTCGGAGAATGCGTCGCCGCGCTCGACGACCGG
CGGGACCCCCCGCAGCGGCGAAGCGGAAGACGAGGCCATCACCGTTGGCGGTGTTACGCCTATGAAGCGCGTCCC
CATCTTGGCCAACTTTGAGGAGTGGATGAAGATGGCGACGGATAACAAGATCAACGCTACCAATTCGTGGAACTT
TGCCCTCATCGACTACTTTCACGATATGTCGCTGCTCAAGGAGGGCGACGGCGTCAATTTCCAAAAGGCCAGCTG
TACTCTCGACGGCTGCGTCAAGATCTACACCAACAGGGTCGACAGCGTCGCCACCGAGACGGGCAAGCTGCTGAG
TGGCCTCGCCGACAGTAGTAACAGCAGCAAGAAGAAAAATGGGGATGAGGCAGCAGAAACGGGCGAGAGCGACGA
AGAGGTCGACGGCGAGGGAAACGTCAGGAAAAAGGCCAAGAAGAAGGTGAGCTCTTTCTTTTTCCTCTTTCTCGT
CCTTGTCCTCCTCCTCCTCCTCTTCTTCTTCTTCTTCTTCAAGCCATCATCGTCGCTGACAACTCGCCCACAGGC
CCAACGATCGTCCGAGGCCACCTTGGCTCCCTCCTTTGCTGCCCTGCAGCTCAAGAAGTTGGAGCTCGAGTTCGC
CGTCGACCCCCTTTTCAAGAAGGCCTCGGCCGACTTCGACGAGGGCGGCGCTAGGGGCCTGCTGCTCAACCACCT
GATGATTGACTCCCGAGGGCGGATCGTCTTTGACAGCAGCGACGACTCGGAAGACGCCGTGGCCCTGGATAAAAG
GAAAGAGGATGGTGACGAAGAGGCCGAAAGCGACGAAGCGGCCGACGACAAGACCAAGAACAAGGAGGAGGAGGA
CGACGACGACGACGACGGCGTTGCCATTGACCTGGCCTCACTCAGCCAAAGATTCTTCCCTGACCTATCTCGGCT
AGACGAGCTCGATGTGTGCCCATCTCTCAAGCAGTTTGATCTTGGAGACGCCTCGGGCTCCATGGACATTCCCTT
TCTCAAGGCGCCGGAAGACTGGCGGACGGACCAGGACAAGGAAAAGACGGGCGGCAGCACCTTGGGCGACAAATC
CGGCGTCTTCTGCGACGAAGATGGGCCGGCCGGCTTCGACGACGACGACGGCGCCCTGGACATGGGCCAGGATGT
GGCCTTTGGTGAGGGCGGCGAGGCCTGGGCACGAGAAGCGGCTCTGGACCCTCAGATGCGCGTCTATGATAGTGG
CAGAACGGGCGACGATGACGACGAAGAGAATGACAATGACGACAAGGCCGAATACGTGGTGGCCATGACGAAGCC
CCAGAGCGCCGACAAGATGCACGAGGACATACTCGGCTTCTTCGACCAGGCGCTGCGCAAGAACTGGACGAGCGC
GGAGCACTGGCGCATCCGCAAGATCAAAGACGGCGCCAAGCCGGCTCCCGACGCAAAGCAGCGACGGAGGGAAAA
GGAGCCGTTCGAGATGGACTTTGCCTCTGCGCTCAACGTCGACGCGCTGTACACGCAGGCGGCCAGTAACGCGGC
CATCAGCATGGCCAAGAAGGATTGGATGTCCAAGTCGCGCAACCTGCTGCCGGACGACAGGCATTTCAGCTCCCG
CTCGCTGCTCAGTCTGTTTCTGAAGCCGAGGGCGCGAATGGCCCGTCGACGGACCCATCATCGTATGCGGCACGA
CGAGGACGATGCCGACGGCGACGACATGGACGAGGCCTTTTGGGCGAAACGCCAGCGGCCTGACGAGATGATGAT
GATGATGGCGACGACGACGACGGCGTCGGCGGCGCTTCCCGAGGGTGACTACGATGCCAATTTCTTTCAAGACGA
CGGCCTCCCCTTTCCCGGCGCTGACGACGACGACGACGACGACGACGACGGGCTGGAGTTTGCCGACGCGCGCGA
ACACATGTCTCCAGGCGTCGTCGTCTTCGGCCAAGCCGAAGCCGTGGGCGCGACGGCCCTCGGAGGAGGAGGAGG
AGGAGGAGGAGGCGAGACCCTGTTTCCCCTGACGCAGCTCTCGGCCGGCGCCTTTGGATCGAGCCTCGTGACGCA
GACGAGGAGGGCGAGACCAGACTATGTGCAGTATGCGCGCAAGGCCAAGAAGGTGGACGTGAGGCGGCTCAAGGA
GGAGATGTGGAAGGGCATGGGGCTGGATAAGCTGTCTGAACCGGTGAGGCCATTCTCTCCCCCTCTCTCTCTCTT
TCTCTCTCTTTTCCTCTTTTTTTTTTTTTTTTTTTCTTCATCCCATGTTGACTCTCTCTCTCCCTCTCCAAAAGG
ACGCCACGGCCAAGCAAAGCAACCGCCTCCCGACTCCGGCGGAAAGCGAGGCGGACGGCATCGGCATCGGCATCG
GCAGCAGCAGCAGCAACGACACCACCCTCCGCTTCAGCGACGTCATCGACGGCCTCCAATCCGTCTACCCCAAGT
CCGTCATGGACGACATCTCGACCTCGTACTGCTTCATCTGCCTGCTCCATCTGGCCAACGAAAAGGGTCTCGCCA
TCGATAAGACGGACGGCCTCGATGAGCTCCTCATTCGCCGAGATTGGTCTGCCGATGCCGTCGACGGGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail