Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2708
Gene name
Locationscaffold_219:23138..26817
Strand-
Gene length (bp)3679
Transcript length (bp)3291
Coding sequence length (bp)3288
Protein length (aa) 1096

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.2E-29 270 408
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 8.1E-26 920 1081

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 217 545 7.0E-47
sp|Q925Q3|NCKX6_MOUSE Sodium/potassium/calcium exchanger 6, mitochondrial OS=Mus musculus GN=Slc8b1 PE=2 SV=2 201 421 4.0E-36
sp|Q6AXS0|NCKX6_RAT Sodium/potassium/calcium exchanger 6, mitochondrial OS=Rattus norvegicus GN=Slc8b1 PE=1 SV=1 207 421 4.0E-35
sp|Q6J4K2|NCKX6_HUMAN Sodium/potassium/calcium exchanger 6, mitochondrial OS=Homo sapiens GN=SLC8B1 PE=1 SV=2 209 420 7.0E-35
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 839 1086 6.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 217 545 7.0E-47
sp|Q925Q3|NCKX6_MOUSE Sodium/potassium/calcium exchanger 6, mitochondrial OS=Mus musculus GN=Slc8b1 PE=2 SV=2 201 421 4.0E-36
sp|Q6AXS0|NCKX6_RAT Sodium/potassium/calcium exchanger 6, mitochondrial OS=Rattus norvegicus GN=Slc8b1 PE=1 SV=1 207 421 4.0E-35
sp|Q6J4K2|NCKX6_HUMAN Sodium/potassium/calcium exchanger 6, mitochondrial OS=Homo sapiens GN=SLC8B1 PE=1 SV=2 209 420 7.0E-35
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 839 1086 6.0E-33
sp|Q6AXS0|NCKX6_RAT Sodium/potassium/calcium exchanger 6, mitochondrial OS=Rattus norvegicus GN=Slc8b1 PE=1 SV=1 849 1086 1.0E-30
sp|Q925Q3|NCKX6_MOUSE Sodium/potassium/calcium exchanger 6, mitochondrial OS=Mus musculus GN=Slc8b1 PE=2 SV=2 849 1086 3.0E-30
sp|Q9FKP1|CCX1_ARATH Cation/calcium exchanger 1 OS=Arabidopsis thaliana GN=CCX1 PE=2 SV=1 198 462 5.0E-29
sp|Q6J4K2|NCKX6_HUMAN Sodium/potassium/calcium exchanger 6, mitochondrial OS=Homo sapiens GN=SLC8B1 PE=1 SV=2 849 1086 2.0E-28
sp|Q9SYG9|CCX4_ARATH Cation/calcium exchanger 4 OS=Arabidopsis thaliana GN=CCX4 PE=2 SV=1 229 425 3.0E-26
sp|Q9LJI2|CCX3_ARATH Cation/calcium exchanger 3 OS=Arabidopsis thaliana GN=CCX3 PE=2 SV=1 229 465 1.0E-25
sp|Q12424|YD206_YEAST Putative cation exchanger YDL206W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL206W PE=1 SV=1 889 1086 4.0E-24
sp|P34322|NCX7_CAEEL Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans GN=ncx-7 PE=3 SV=3 260 430 2.0E-22
sp|O04034|CCX5_ARATH Cation/calcium exchanger 5 OS=Arabidopsis thaliana GN=CCX5 PE=2 SV=1 906 1084 4.0E-21
sp|P34315|NCX6_CAEEL Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans GN=ncx-6 PE=3 SV=3 890 1002 6.0E-21
sp|P34315|NCX6_CAEEL Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans GN=ncx-6 PE=3 SV=3 269 430 7.0E-21
sp|P34322|NCX7_CAEEL Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans GN=ncx-7 PE=3 SV=3 849 1089 4.0E-20
sp|Q9FKP2|CCX2_ARATH Cation/calcium exchanger 2 OS=Arabidopsis thaliana GN=CCX2 PE=3 SV=1 211 482 6.0E-18
sp|O04034|CCX5_ARATH Cation/calcium exchanger 5 OS=Arabidopsis thaliana GN=CCX5 PE=2 SV=1 182 405 3.0E-17
sp|Q12424|YD206_YEAST Putative cation exchanger YDL206W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL206W PE=1 SV=1 276 432 5.0E-17
sp|Q9SYG9|CCX4_ARATH Cation/calcium exchanger 4 OS=Arabidopsis thaliana GN=CCX4 PE=2 SV=1 885 1076 3.0E-16
sp|Q9FKP1|CCX1_ARATH Cation/calcium exchanger 1 OS=Arabidopsis thaliana GN=CCX1 PE=2 SV=1 897 1083 7.0E-16
sp|Q9LJI2|CCX3_ARATH Cation/calcium exchanger 3 OS=Arabidopsis thaliana GN=CCX3 PE=2 SV=1 899 1076 3.0E-15
sp|Q8CGQ8|NCKX4_MOUSE Sodium/potassium/calcium exchanger 4 OS=Mus musculus GN=Slc24a4 PE=2 SV=2 898 1087 2.0E-12
sp|Q9FKP2|CCX2_ARATH Cation/calcium exchanger 2 OS=Arabidopsis thaliana GN=CCX2 PE=3 SV=1 868 1002 3.0E-12
sp|Q8NFF2|NCKX4_HUMAN Sodium/potassium/calcium exchanger 4 OS=Homo sapiens GN=SLC24A4 PE=1 SV=2 898 1087 6.0E-12
sp|Q9UI40|NCKX2_HUMAN Sodium/potassium/calcium exchanger 2 OS=Homo sapiens GN=SLC24A2 PE=1 SV=1 904 1085 1.0E-11
sp|O54701|NCKX2_RAT Sodium/potassium/calcium exchanger 2 OS=Rattus norvegicus GN=Slc24a2 PE=1 SV=1 261 406 2.0E-11
sp|O54701|NCKX2_RAT Sodium/potassium/calcium exchanger 2 OS=Rattus norvegicus GN=Slc24a2 PE=1 SV=1 904 1085 3.0E-11
sp|Q9UI40|NCKX2_HUMAN Sodium/potassium/calcium exchanger 2 OS=Homo sapiens GN=SLC24A2 PE=1 SV=1 261 406 3.0E-11
sp|Q9HC58|NCKX3_HUMAN Sodium/potassium/calcium exchanger 3 OS=Homo sapiens GN=SLC24A3 PE=2 SV=4 901 1087 1.0E-10
sp|P47144|ECM27_YEAST Protein ECM27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM27 PE=1 SV=2 931 1009 2.0E-10
sp|Q28139|NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus GN=SLC24A1 PE=1 SV=2 275 408 2.0E-10
sp|Q9IAL7|NCKX2_CHICK Sodium/potassium/calcium exchanger 2 OS=Gallus gallus GN=SLC24A2 PE=2 SV=1 911 1085 2.0E-10
sp|Q9IAL8|NCKX1_CHICK Sodium/potassium/calcium exchanger 1 OS=Gallus gallus GN=SLC24A1 PE=2 SV=1 275 408 2.0E-10
sp|Q99PD7|NCKX3_MOUSE Sodium/potassium/calcium exchanger 3 OS=Mus musculus GN=Slc24a3 PE=1 SV=3 923 1087 3.0E-10
sp|Q9EPQ0|NCKX3_RAT Sodium/potassium/calcium exchanger 3 (Fragment) OS=Rattus norvegicus GN=Slc24a3 PE=1 SV=1 923 1087 4.0E-10
sp|Q8NFF2|NCKX4_HUMAN Sodium/potassium/calcium exchanger 4 OS=Homo sapiens GN=SLC24A4 PE=1 SV=2 275 406 6.0E-10
sp|Q8CGQ8|NCKX4_MOUSE Sodium/potassium/calcium exchanger 4 OS=Mus musculus GN=Slc24a4 PE=2 SV=2 275 408 7.0E-10
sp|Q9IAL7|NCKX2_CHICK Sodium/potassium/calcium exchanger 2 OS=Gallus gallus GN=SLC24A2 PE=2 SV=1 261 430 8.0E-10
sp|O60721|NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens GN=SLC24A1 PE=1 SV=1 275 408 1.0E-09
sp|Q99PD7|NCKX3_MOUSE Sodium/potassium/calcium exchanger 3 OS=Mus musculus GN=Slc24a3 PE=1 SV=3 275 408 2.0E-09
sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus GN=Slc24a1 PE=2 SV=1 896 1085 2.0E-09
sp|Q8TPA6|MAX1_METAC Sodium/calcium exchanger MaX1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=maX1 PE=1 SV=1 283 405 2.0E-09
sp|Q9HC58|NCKX3_HUMAN Sodium/potassium/calcium exchanger 3 OS=Homo sapiens GN=SLC24A3 PE=2 SV=4 275 408 4.0E-09
sp|Q9EPQ0|NCKX3_RAT Sodium/potassium/calcium exchanger 3 (Fragment) OS=Rattus norvegicus GN=Slc24a3 PE=1 SV=1 275 408 4.0E-09
sp|Q9U6A0|NCKX_DROME Sodium/potassium/calcium exchanger Nckx30C OS=Drosophila melanogaster GN=Nckx30C PE=2 SV=4 275 405 5.0E-09
sp|O60721|NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens GN=SLC24A1 PE=1 SV=1 894 1000 1.0E-08
sp|Q9VN12|NCKXH_DROME Probable sodium/potassium/calcium exchanger CG1090 OS=Drosophila melanogaster GN=CG1090 PE=2 SV=3 923 1087 2.0E-08
sp|Q28139|NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus GN=SLC24A1 PE=1 SV=2 896 1085 4.0E-08
sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus GN=Slc24a1 PE=2 SV=1 266 408 4.0E-08
sp|Q9U6A0|NCKX_DROME Sodium/potassium/calcium exchanger Nckx30C OS=Drosophila melanogaster GN=Nckx30C PE=2 SV=4 904 1085 1.0E-07
sp|Q9IAL8|NCKX1_CHICK Sodium/potassium/calcium exchanger 1 OS=Gallus gallus GN=SLC24A1 PE=2 SV=1 905 1085 1.0E-07
sp|Q49SH1|NCKX5_DANRE Sodium/potassium/calcium exchanger 5 OS=Danio rerio GN=slc24a5 PE=2 SV=1 879 1086 1.0E-07
sp|Q8C261|NCKX5_MOUSE Sodium/potassium/calcium exchanger 5 OS=Mus musculus GN=Slc24a5 PE=2 SV=1 893 1086 2.0E-07
sp|Q71RS6|NCKX5_HUMAN Sodium/potassium/calcium exchanger 5 OS=Homo sapiens GN=SLC24A5 PE=1 SV=1 275 412 5.0E-07
sp|Q71RS6|NCKX5_HUMAN Sodium/potassium/calcium exchanger 5 OS=Homo sapiens GN=SLC24A5 PE=1 SV=1 877 1086 7.0E-07
sp|P47144|ECM27_YEAST Protein ECM27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM27 PE=1 SV=2 276 451 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 179 196 17
2 262 284 22
3 335 357 22
4 370 392 22
5 397 416 19
6 848 870 22
7 885 904 19
8 917 939 22
9 944 966 22
10 987 1009 22
11 1033 1055 22
12 1068 1090 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 62.41 32.39 92.42
CcL In ants, during behavior modification 61.72 30.15 93.29
CcD In ants, recently dead 54.85 29.13 80.58

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.972295 no
SC16a CcD 0.630004 no
CcL CcD 0.676078 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2708
MAVDAVASDETQTRAANQKQVTFRLTPPLVAHGHHHIWIRQICNNEHELRAYLGPNKLPTAKRAIRAVFTPPSLS
ITYTHTSTTSPSSPATSPLPLPPPPPPPPLPPPPLPQTLAGIHPSTCGGPAAWLIRPFKTRPQPLAPFPSSAPSS
HPYCSASWSRHHDDSTSMPSHRSRLSSRPFFITLLALAILTAYSFVRARDQPPSSDHGFTSAPLRRNDETECRNL
DAVADQCAFVKRHCADVDAGLLPYLELYYCTHLRARSLAFCLLVAWLGLLFTTIGIAASDFFCVNLATISSVLGL
SQSLAGVTFLALGNGSPDVFSTFAAMSSNSPGMAIGELIGAASFITGVVAGSMALVREFRVDRESYARDICFFIV
AAAFTLAFLADGQLHIWECCVMVGYYVLYVVTVVICHWWGVRRRRRLRRDGEARSHVYTMVGHAAEELAGEPYRD
DPEHGHRTPLSATPTPVDASPLVLDVDGDHERMVAAEMTRNMRIVRVGAKRPTCATPIRPSLVGALEFRSAMAQL
QRESNLQLSPLLIRRQSEAYSRPRLRRGTTCNALHVSSADGIDASTAIPGVTRRDRALSSSDIPNTPAAVPDLLG
PRQGRPRSRFLLPEAAETERTSRSLTPPLSITEVEPSDETDNGSPREPTPKLRLQIPSQERSHSAGSSPRVEFPR
YVDPVVALNANALSEQRVDQLQPSASVPGPLRWWPYWALPPPHILLTALFPTLQGWHEKSYWDRLLSAISVPSIF
LLVVTLPVVDTEATEDATCVHETLSDSPGYGAMDGSAPAISVIPAGAQLEAGWDDHAMSAAPDLLAEPTDQLLSS
AAVSAKAPSEVRSVSKANDEAALWNRWLVCVQLFSGPLFSTVVLWANLREDMRQPGRELARMIAFSLMLSVLLLG
VVLLTTTEQRRPRLHYLLCFLGFVISVAWISTIAGEVVGVLKAFGVILGISEALLGLTVFAAGNSIGDLVADITV
ARLGYPVMALSACFGGPMLNILLGIGIGGVIMMVKQAKHEHAKYPDRPMRYGPYKMQLGATLFVSGVTLLLILVL
LVVLVPVNKWILSRKIGWVVIILWIVSTAVSVAIELTGIWSEAAGL
Coding >Ophio5|2708
ATGGCTGTAGATGCGGTCGCGTCCGACGAGACCCAAACTAGGGCAGCTAACCAAAAACAGGTAACCTTCCGTCTC
ACACCGCCACTTGTGGCTCACGGCCATCACCACATCTGGATTCGGCAAATTTGCAACAATGAGCATGAGCTGAGG
GCCTACCTGGGCCCAAACAAACTCCCCACAGCCAAGAGGGCGATCCGGGCCGTCTTCACCCCTCCATCTCTCTCC
ATCACATACACACACACATCAACAACCTCGCCGTCCTCACCTGCTACTTCTCCTCTTCCTCTTCCTCCTCCTCCG
CCTCCTCCTCCTCTGCCTCCTCCTCCTCTGCCTCAGACACTGGCTGGAATCCACCCCTCAACATGTGGCGGACCC
GCCGCCTGGCTTATTAGGCCCTTCAAGACCCGCCCTCAACCGCTCGCCCCCTTTCCCTCCTCGGCTCCTTCGTCG
CACCCGTATTGCTCGGCTTCCTGGTCGCGGCACCATGACGATTCAACAAGCATGCCCTCTCATCGCTCCAGACTC
TCGTCTCGCCCTTTCTTCATCACCCTTCTCGCCCTCGCCATCCTGACCGCCTACTCGTTTGTCCGAGCCCGCGAC
CAGCCACCCTCGTCCGACCATGGCTTCACTTCCGCACCCCTTCGGCGCAACGACGAGACCGAATGCCGCAATCTC
GATGCCGTCGCCGACCAGTGCGCCTTCGTCAAGCGTCATTGCGCCGATGTCGACGCCGGCCTGCTCCCCTATCTC
GAGCTCTACTACTGCACTCATCTACGCGCCCGCTCCCTGGCCTTTTGCTTGCTCGTCGCTTGGCTGGGCCTGCTC
TTCACCACCATCGGCATCGCCGCCAGCGACTTCTTCTGCGTCAACCTCGCCACCATCTCCTCCGTCCTCGGCCTG
AGCCAGAGCCTGGCTGGCGTCACCTTCCTGGCTCTCGGCAACGGTTCTCCCGACGTCTTCAGCACTTTTGCCGCC
ATGAGCTCAAATAGCCCGGGCATGGCCATCGGCGAACTCATCGGCGCCGCTAGCTTCATCACCGGTGTTGTCGCT
GGCTCCATGGCCCTGGTACGAGAGTTCCGCGTCGACCGAGAGTCGTACGCCCGCGACATCTGCTTCTTCATCGTT
GCCGCCGCCTTCACCCTGGCCTTTCTGGCCGACGGCCAACTTCATATCTGGGAGTGCTGCGTCATGGTCGGCTAC
TACGTCCTTTACGTCGTCACTGTCGTAATCTGCCACTGGTGGGGAGTCAGGAGGAGACGGCGGCTTCGACGAGAC
GGAGAGGCTCGCAGCCATGTTTACACCATGGTAGGTCACGCTGCTGAAGAGCTGGCGGGCGAGCCGTATCGAGAC
GACCCGGAGCACGGTCACCGGACACCGCTCTCGGCCACCCCTACTCCCGTCGATGCCAGCCCGCTCGTCCTTGAC
GTCGACGGCGATCACGAAAGGATGGTGGCAGCCGAAATGACGAGGAATATGCGCATCGTCCGGGTTGGGGCGAAG
CGTCCTACCTGCGCGACTCCCATCCGTCCGAGCTTGGTCGGCGCCCTCGAGTTCCGCTCCGCTATGGCGCAGCTC
CAGCGCGAGAGCAATCTGCAGCTCTCACCCTTACTGATCCGACGCCAGTCCGAAGCCTACTCGCGGCCCAGGCTG
CGGCGGGGGACGACGTGCAATGCCCTGCACGTGAGCAGCGCCGACGGCATCGATGCTTCGACTGCTATCCCGGGC
GTCACGCGCCGCGACCGAGCACTGTCGTCAAGCGATATCCCAAATACCCCGGCCGCCGTACCTGACCTCCTGGGG
CCACGGCAAGGCAGACCTAGGTCTCGATTTCTGTTGCCCGAGGCGGCCGAGACGGAGCGGACAAGCCGGTCCCTA
ACGCCACCGCTGTCCATAACAGAAGTTGAGCCGTCAGACGAGACGGACAATGGCTCGCCGCGGGAACCCACTCCG
AAGCTGCGGTTGCAAATTCCAAGTCAGGAAAGGAGCCATAGCGCAGGATCCTCCCCTCGGGTGGAATTTCCCCGC
TACGTAGATCCGGTCGTTGCCCTGAATGCGAACGCGCTCTCGGAACAACGGGTCGATCAGCTGCAGCCATCGGCA
TCGGTGCCTGGTCCGCTGCGATGGTGGCCTTATTGGGCGCTTCCCCCGCCTCACATTCTGTTGACGGCGCTGTTC
CCGACCTTGCAAGGCTGGCATGAAAAGTCTTACTGGGATCGCCTTCTCAGCGCGATATCGGTGCCGAGCATCTTT
CTCTTGGTGGTAACGCTGCCCGTCGTCGACACGGAGGCAACCGAGGATGCCACGTGTGTCCATGAAACCCTGTCC
GACAGCCCGGGATACGGCGCCATGGATGGTTCGGCGCCAGCGATTTCCGTAATCCCAGCCGGCGCGCAGCTCGAA
GCCGGCTGGGATGACCATGCCATGTCTGCGGCGCCAGACTTGTTGGCGGAACCGACAGATCAACTCTTGTCAAGC
GCGGCCGTCTCTGCCAAGGCACCGTCGGAGGTCCGGTCGGTCAGCAAGGCCAACGACGAGGCGGCGCTCTGGAAT
CGCTGGCTCGTATGCGTGCAGCTCTTCAGCGGGCCGCTGTTCTCGACCGTGGTCCTATGGGCCAACCTACGAGAG
GACATGAGACAGCCGGGAAGAGAACTGGCGCGGATGATTGCCTTTTCGCTGATGCTCTCAGTCTTACTACTGGGC
GTGGTGCTCCTGACGACGACGGAGCAAAGGCGGCCGAGGCTTCACTATCTGTTGTGCTTCCTGGGCTTCGTCATC
AGTGTGGCGTGGATCTCGACCATCGCGGGCGAGGTGGTCGGCGTGCTCAAGGCCTTTGGGGTGATACTGGGTATC
TCGGAGGCGCTGCTAGGTCTGACCGTCTTTGCCGCGGGCAACAGCATCGGAGACCTGGTAGCGGACATCACCGTG
GCACGGCTCGGGTATCCCGTCATGGCGCTATCGGCGTGCTTTGGAGGCCCTATGCTTAACATCCTGCTGGGCATC
GGCATCGGAGGCGTCATCATGATGGTCAAGCAGGCCAAGCATGAGCACGCCAAGTACCCCGACAGACCGATGCGT
TACGGCCCGTACAAAATGCAGCTGGGAGCGACGCTCTTTGTGTCGGGCGTGACACTGCTCCTTATTCTTGTACTC
CTCGTCGTGCTCGTGCCGGTGAACAAGTGGATCCTGAGCCGCAAGATCGGATGGGTCGTCATCATACTGTGGATC
GTCAGTACCGCTGTGAGCGTGGCGATCGAGCTGACGGGGATATGGAGCGAGGCGGCGGGACTC
Transcript >Ophio5|2708
ATGGCTGTAGATGCGGTCGCGTCCGACGAGACCCAAACTAGGGCAGCTAACCAAAAACAGGTAACCTTCCGTCTC
ACACCGCCACTTGTGGCTCACGGCCATCACCACATCTGGATTCGGCAAATTTGCAACAATGAGCATGAGCTGAGG
GCCTACCTGGGCCCAAACAAACTCCCCACAGCCAAGAGGGCGATCCGGGCCGTCTTCACCCCTCCATCTCTCTCC
ATCACATACACACACACATCAACAACCTCGCCGTCCTCACCTGCTACTTCTCCTCTTCCTCTTCCTCCTCCTCCG
CCTCCTCCTCCTCTGCCTCCTCCTCCTCTGCCTCAGACACTGGCTGGAATCCACCCCTCAACATGTGGCGGACCC
GCCGCCTGGCTTATTAGGCCCTTCAAGACCCGCCCTCAACCGCTCGCCCCCTTTCCCTCCTCGGCTCCTTCGTCG
CACCCGTATTGCTCGGCTTCCTGGTCGCGGCACCATGACGATTCAACAAGCATGCCCTCTCATCGCTCCAGACTC
TCGTCTCGCCCTTTCTTCATCACCCTTCTCGCCCTCGCCATCCTGACCGCCTACTCGTTTGTCCGAGCCCGCGAC
CAGCCACCCTCGTCCGACCATGGCTTCACTTCCGCACCCCTTCGGCGCAACGACGAGACCGAATGCCGCAATCTC
GATGCCGTCGCCGACCAGTGCGCCTTCGTCAAGCGTCATTGCGCCGATGTCGACGCCGGCCTGCTCCCCTATCTC
GAGCTCTACTACTGCACTCATCTACGCGCCCGCTCCCTGGCCTTTTGCTTGCTCGTCGCTTGGCTGGGCCTGCTC
TTCACCACCATCGGCATCGCCGCCAGCGACTTCTTCTGCGTCAACCTCGCCACCATCTCCTCCGTCCTCGGCCTG
AGCCAGAGCCTGGCTGGCGTCACCTTCCTGGCTCTCGGCAACGGTTCTCCCGACGTCTTCAGCACTTTTGCCGCC
ATGAGCTCAAATAGCCCGGGCATGGCCATCGGCGAACTCATCGGCGCCGCTAGCTTCATCACCGGTGTTGTCGCT
GGCTCCATGGCCCTGGTACGAGAGTTCCGCGTCGACCGAGAGTCGTACGCCCGCGACATCTGCTTCTTCATCGTT
GCCGCCGCCTTCACCCTGGCCTTTCTGGCCGACGGCCAACTTCATATCTGGGAGTGCTGCGTCATGGTCGGCTAC
TACGTCCTTTACGTCGTCACTGTCGTAATCTGCCACTGGTGGGGAGTCAGGAGGAGACGGCGGCTTCGACGAGAC
GGAGAGGCTCGCAGCCATGTTTACACCATGGTAGGTCACGCTGCTGAAGAGCTGGCGGGCGAGCCGTATCGAGAC
GACCCGGAGCACGGTCACCGGACACCGCTCTCGGCCACCCCTACTCCCGTCGATGCCAGCCCGCTCGTCCTTGAC
GTCGACGGCGATCACGAAAGGATGGTGGCAGCCGAAATGACGAGGAATATGCGCATCGTCCGGGTTGGGGCGAAG
CGTCCTACCTGCGCGACTCCCATCCGTCCGAGCTTGGTCGGCGCCCTCGAGTTCCGCTCCGCTATGGCGCAGCTC
CAGCGCGAGAGCAATCTGCAGCTCTCACCCTTACTGATCCGACGCCAGTCCGAAGCCTACTCGCGGCCCAGGCTG
CGGCGGGGGACGACGTGCAATGCCCTGCACGTGAGCAGCGCCGACGGCATCGATGCTTCGACTGCTATCCCGGGC
GTCACGCGCCGCGACCGAGCACTGTCGTCAAGCGATATCCCAAATACCCCGGCCGCCGTACCTGACCTCCTGGGG
CCACGGCAAGGCAGACCTAGGTCTCGATTTCTGTTGCCCGAGGCGGCCGAGACGGAGCGGACAAGCCGGTCCCTA
ACGCCACCGCTGTCCATAACAGAAGTTGAGCCGTCAGACGAGACGGACAATGGCTCGCCGCGGGAACCCACTCCG
AAGCTGCGGTTGCAAATTCCAAGTCAGGAAAGGAGCCATAGCGCAGGATCCTCCCCTCGGGTGGAATTTCCCCGC
TACGTAGATCCGGTCGTTGCCCTGAATGCGAACGCGCTCTCGGAACAACGGGTCGATCAGCTGCAGCCATCGGCA
TCGGTGCCTGGTCCGCTGCGATGGTGGCCTTATTGGGCGCTTCCCCCGCCTCACATTCTGTTGACGGCGCTGTTC
CCGACCTTGCAAGGCTGGCATGAAAAGTCTTACTGGGATCGCCTTCTCAGCGCGATATCGGTGCCGAGCATCTTT
CTCTTGGTGGTAACGCTGCCCGTCGTCGACACGGAGGCAACCGAGGATGCCACGTGTGTCCATGAAACCCTGTCC
GACAGCCCGGGATACGGCGCCATGGATGGTTCGGCGCCAGCGATTTCCGTAATCCCAGCCGGCGCGCAGCTCGAA
GCCGGCTGGGATGACCATGCCATGTCTGCGGCGCCAGACTTGTTGGCGGAACCGACAGATCAACTCTTGTCAAGC
GCGGCCGTCTCTGCCAAGGCACCGTCGGAGGTCCGGTCGGTCAGCAAGGCCAACGACGAGGCGGCGCTCTGGAAT
CGCTGGCTCGTATGCGTGCAGCTCTTCAGCGGGCCGCTGTTCTCGACCGTGGTCCTATGGGCCAACCTACGAGAG
GACATGAGACAGCCGGGAAGAGAACTGGCGCGGATGATTGCCTTTTCGCTGATGCTCTCAGTCTTACTACTGGGC
GTGGTGCTCCTGACGACGACGGAGCAAAGGCGGCCGAGGCTTCACTATCTGTTGTGCTTCCTGGGCTTCGTCATC
AGTGTGGCGTGGATCTCGACCATCGCGGGCGAGGTGGTCGGCGTGCTCAAGGCCTTTGGGGTGATACTGGGTATC
TCGGAGGCGCTGCTAGGTCTGACCGTCTTTGCCGCGGGCAACAGCATCGGAGACCTGGTAGCGGACATCACCGTG
GCACGGCTCGGGTATCCCGTCATGGCGCTATCGGCGTGCTTTGGAGGCCCTATGCTTAACATCCTGCTGGGCATC
GGCATCGGAGGCGTCATCATGATGGTCAAGCAGGCCAAGCATGAGCACGCCAAGTACCCCGACAGACCGATGCGT
TACGGCCCGTACAAAATGCAGCTGGGAGCGACGCTCTTTGTGTCGGGCGTGACACTGCTCCTTATTCTTGTACTC
CTCGTCGTGCTCGTGCCGGTGAACAAGTGGATCCTGAGCCGCAAGATCGGATGGGTCGTCATCATACTGTGGATC
GTCAGTACCGCTGTGAGCGTGGCGATCGAGCTGACGGGGATATGGAGCGAGGCGGCGGGACTCTGA
Gene >Ophio5|2708
ATGGCTGTAGATGCGGTCGCGTCCGACGAGACCCAAAGTAAACAAAAAAGAAACCGACGACTGCGCCACACAAGC
CGGGCAAGCAAGCAAGCAAGCAAACCAACCAACCAACCAACCAACCAATCAAGCAACTAACTACCCAGCTAGGGC
AGCTAACCAAAAACAGGTAACCTTCCGTCTCACACCGCCACTTGTGGCTCACGGCCATCACGTGAGTCACCTATC
CGCTCCATGACGACGGCGCCAAGCATTCGGGCGGCGAGTGCCGCGAGGCTGAGTTGCAGACGGACGCGTAACACT
ATCCTCGTACATACCTACCTATATACTGTGTTGCTTTCTCCCTGCGTCTTTACAGCACATCTGGATTCGGCAAAT
TTGCAACAATGAGCATGAGCTGAGGGTAAGTAAGAGAGGTGTATATAAGAGGTACGACGCCTCGTTAGCTAAGCC
TCCACCAGGCCCTTGACGGCTAACTCGGGCTTAGGCCTACCTGGGCCCAAACAAACTCCCCACAGCCAAGAGGGC
GATCCGGGCCGTCTTCACCCCTCCATCTCTCTCCATCACATACACACACACATCAACAACCTCGCCGTCCTCACC
TGCTACTTCTCCTCTTCCTCTTCCTCCTCCTCCGCCTCCTCCTCCTCTGCCTCCTCCTCCTCTGCCTCAGACACT
GGCTGGAATCCACCCCTCAACATGTGGCGGACCCGCCGCCTGGCTTATTAGGCCCTTCAAGACCCGCCCTCAACC
GCTCGCCCCCTTTCCCTCCTCGGCTCCTTCGTCGCACCCGTATTGCTCGGCTTCCTGGTCGCGGCACCATGACGA
TTCAACAAGCATGCCCTCTCATCGCTCCAGACTCTCGTCTCGCCCTTTCTTCATCACCCTTCTCGCCCTCGCCAT
CCTGACCGCCTACTCGTTTGTCCGAGCCCGCGACCAGCCACCCTCGTCCGACCATGGCTTCACTTCCGCACCCCT
TCGGCGCAACGACGAGACCGAATGCCGCAATCTCGATGCCGTCGCCGACCAGTGCGCCTTCGTCAAGCGTCATTG
CGCCGATGTCGACGCCGGCCTGCTCCCCTATCTCGAGCTCTACTACTGCACTCATCTACGCGCCCGCTCCCTGGC
CTTTTGCTTGCTCGTCGCTTGGCTGGGCCTGCTCTTCACCACCATCGGCATCGCCGCCAGCGACTTCTTCTGCGT
CAACCTCGCCACCATCTCCTCCGTCCTCGGCCTGAGCCAGAGCCTGGCTGGCGTCACCTTCCTGGCTCTCGGCAA
CGGTTCTCCCGACGTCTTCAGCACTTTTGCCGCCATGAGCTCAAATAGCCCGGGCATGGCCATCGGCGAACTCAT
CGGCGCCGCTAGCTTCATCACCGGTGTTGTCGCTGGCTCCATGGCCCTGGTACGAGAGTTCCGCGTCGACCGAGA
GTCGTACGCCCGCGACATCTGCTTCTTCATCGTTGCCGCCGCCTTCACCCTGGCCTTTCTGGCCGACGGCCAACT
TCATATCTGGGAGTGCTGCGTCATGGTCGGCTACTACGTCCTTTACGTCGTCACTGTCGTAATCTGCCACTGGTG
GGGAGTCAGGAGGAGACGGCGGCTTCGACGAGACGGAGAGGCTCGCAGCCATGTTTACACCATGGTAGGTCACGC
TGCTGAAGAGCTGGCGGGCGAGCCGTATCGAGACGACCCGGAGCACGGTCACCGGACACCGCTCTCGGCCACCCC
TACTCCCGTCGATGCCAGCCCGCTCGTCCTTGACGTCGACGGCGATCACGAAAGGATGGTGGCAGCCGAAATGAC
GAGGAATATGCGCATCGTCCGGGTTGGGGCGAAGCGTCCTACCTGCGCGACTCCCATCCGTCCGAGCTTGGTCGG
CGCCCTCGAGTTCCGCTCCGCTATGGCGCAGCTCCAGCGCGAGAGCAATCTGCAGCTCTCACCCTTACTGATCCG
ACGCCAGTCCGAAGCCTACTCGCGGCCCAGGCTGCGGCGGGGGACGACGTGCAATGCCCTGCACGTGAGCAGCGC
CGACGGCATCGATGCTTCGACTGCTATCCCGGGCGTCACGCGCCGCGACCGAGCACTGTCGTCAAGCGATATCCC
AAATACCCCGGCCGCCGTACCTGACCTCCTGGGGCCACGGCAAGGCAGACCTAGGTCTCGATTTCTGTTGCCCGA
GGCGGCCGAGACGGAGCGGACAAGCCGGTCCCTAACGCCACCGCTGTCCATAACAGAAGTTGAGCCGTCAGACGA
GACGGACAATGGCTCGCCGCGGGAACCCACTCCGAAGCTGCGGTTGCAAATTCCAAGTCAGGAAAGGAGCCATAG
CGCAGGATCCTCCCCTCGGGTGGAATTTCCCCGCTACGTAGATCCGGTCGTTGCCCTGAATGCGAACGCGCTCTC
GGAACAACGGGTCGATCAGCTGCAGCCATCGGCATCGGTGCCTGGTCCGCTGCGATGGTGGCCTTATTGGGCGCT
TCCCCCGCCTCACATTCTGTTGACGGCGCTGTTCCCGACCTTGCAAGGCTGGCATGAAAAGTCTTACTGGGATCG
CCTTCTCAGCGCGATATCGGTGCCGAGCATCTTTCTCTTGGTGGTAACGCTGCCCGTCGTCGACACGGAGGCAAC
CGAGGATGCCACGTGTGTCCATGAAACCCTGTCCGACAGCCCGGGATACGGCGCCATGGATGGTTCGGCGCCAGC
GATTTCCGTAATCCCAGCCGGCGCGCAGCTCGAAGCCGGCTGGGATGACCATGCCATGTCTGCGGCGCCAGACTT
GTTGGCGGAACCGACAGATCAACTCTTGTCAAGCGCGGCCGTCTCTGCCAAGGCACCGTCGGAGGTCCGGTCGGT
CAGCAAGGCCAACGACGAGGCGGCGCTCTGGAATCGCTGGCTCGTATGCGTGCAGCTCTTCAGCGGGCCGCTGTT
CTCGACCGTGGTCCTATGGGCCAACCTACGAGAGGACATGAGACAGCCGGGAAGAGAACTGGCGCGGATGATTGC
CTTTTCGCTGATGCTCTCAGTCTTACTACTGGGCGTGGTGCTCCTGACGACGACGGAGCAAAGGCGGCCGAGGCT
TCACTATCTGTTGTGCTTCCTGGGCTTCGTCATCAGTGTGGCGTGGATCTCGACCATCGCGGGCGAGGTGGTCGG
CGTGCTCAAGGCCTTTGGGGTGATACTGGGTATCTCGGAGGCGCTGCTAGGTCTGACCGTCTTTGCCGCGGGCAA
CAGCATCGGAGACCTGGTAGCGGACATCACCGTGGCACGGCTCGGGTATCCCGTCATGGCGCTGTAAGTAAGTCC
CTCTCGGGAGACGGGTGAGTATGCTGACGACTGTCGGTACAGATCGGCGTGCTTTGGAGGCCCTATGCTTAACAT
CCTGCTGGGCATCGGCATCGGAGGCGTCATCATGATGGTCAAGCAGGCCAAGCATGAGCACGCCAAGTACCCCGA
CAGACCGATGCGTTACGGCCCGTACAAAATGCAGCTGGGAGCGACGCTCTTTGTGTCGGGCGTGACACTGCTCCT
TATTCTTGTACTCCTCGTCGTGCTCGTGCCGGTGAACAAGTGGATCCTGAGCCGCAAGATCGGATGGGTCGTCAT
CATACTGTGGATCGTCAGTACCGCTGTGAGCGTGGCGATCGAGCTGACGGGGATATGGAGCGAGGCGGCGGGACT
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail