Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2706
Gene name
Locationscaffold_219:17457..21162
Strand+
Gene length (bp)3705
Transcript length (bp)3564
Coding sequence length (bp)3561
Protein length (aa) 1187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19050 PhoD_2 PhoD related phosphatase 0.0E+00 618 1187
PF00397 WW WW domain 7.3E-10 434 464

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53326|YG5L_YEAST Uncharacterized protein YGR266W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR266W PE=1 SV=1 545 1099 3.0E-45

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2706
MAATRSVPEEEMFLSKPAPADSPTVRPLRIFKSQSPGPVVRTDPSASLPSFPLPPGASSSAAPLPFPDDDYICKP
AHAKPFNSPCNDTSPRIDTNVPQKRPGLAERRGASPKVIHSPSSPDADPQYFPRPLKEQALPASSQSGRLYPQNK
TYYPPPAAGPPLWSVPDSGPHPRLSDQHLKTDEQCVNRFASTASNYTTKATRGSPPPPETPIAEPGTVPGGGIEA
RYAASGISGTATLNSLQAHQAQSAAASQRLPQFGNQPPQPQRPWTPTESPGQAPSGPPTVYQGTTPISSSGVRLT
FSPPPDQPVPKDGNPALQVSVLEQDFQRMGTKTPPPAYSKVNPNGGSPGAREKQRPQQRTSGPDTSHDGSTSSPP
SKPVAASAMPATALASPALQHPGHPAFANDPRPEANGQALEVVSTASPPAQTPASPPPLPEGWIAHLDQNSGQYY
YIHLASQATQWEFPKGPNPIQHEQTPLSPTASTYGNPLTSPMFGKQPMASPMFAPHTPGGYAESIMSVAASQAPS
AAGFSGPPPSSGVSMYRVQPTNGVYFGPYLRYVNMDVEKGTWYGSIMIVTDAPQPPTIHIHLSVDLSPNPRQLQP
HVIYTHQRWTFYRYEVDLQMGEGGTERWTYAVTSHLGCTRYEFVVAGRHETGWRFIAHSGNDFASNTSQNERARL
GGVGFMWKDVLQKNIDCGGFHAQLGLGSQIYADRLWKEVPLLKQWLAMSGRDNKKNTQWTARHEEDVTHAYFHFY
TSHFDQPFLREAFAQIPHVLQINDHDIFDGYGSYPPYMQAWPMFKNIGRIATDMYLLFQHHTTVEIMRNVSTDLD
IFTVTGAGWHFVKFLGPAVAVVGADCRSERTQARVLAGPTYQGIFPRVAMLPPSVQHVIWMISVPIIYPRLDTVE
SLANTVAAGKKAVNTTYNILGKVTSSMAGVVGGKEVVAQGFTHVKKAVGKTGLMGNVLNQFGELDIHEILKDMWT
HDSKDLERTYLIRTLQGIAQQKGIRMTFLSGDVNASGAGLVHDPTHPGDHKTMYQIISSPMVGAPQGGYVSKLLH
NQKTLYVPLNGQRSTHEVSDTKEDMMEIFHTDASGASRELKKLMNRRNYVTFFAFDQEAASHPAPFSSGSSMSDQ
QQQQQQQQQQQQQQVVLQQQQQQQQGLSRLGLAVDFVVQGDGAYQATTKYGPVVIPHLEYGR
Coding >Ophio5|2706
ATGGCGGCGACTCGGAGCGTGCCCGAGGAGGAAATGTTCCTCAGCAAGCCCGCACCCGCCGATAGCCCTACTGTC
CGGCCTCTGCGTATCTTCAAGTCTCAGAGCCCCGGACCTGTCGTTCGCACTGATCCATCCGCTTCACTACCCAGC
TTCCCGCTGCCGCCGGGTGCCTCCAGCTCCGCGGCCCCGCTACCGTTCCCCGATGACGATTACATCTGCAAGCCG
GCTCACGCAAAGCCTTTCAACTCGCCCTGCAACGATACGAGCCCTCGGATAGACACTAACGTACCGCAGAAGCGG
CCGGGCCTTGCCGAGCGGAGGGGAGCGTCGCCCAAAGTCATCCACTCCCCCTCCAGCCCCGACGCTGATCCCCAA
TACTTTCCAAGGCCACTCAAGGAACAGGCGCTGCCCGCGTCTTCCCAATCGGGTCGTCTATACCCACAGAATAAG
ACATATTACCCTCCGCCGGCTGCCGGACCGCCGCTCTGGTCCGTGCCCGACAGCGGCCCGCATCCCCGACTATCC
GACCAGCACTTGAAGACGGACGAGCAGTGTGTGAACCGCTTCGCTTCGACGGCCTCCAACTACACGACCAAGGCA
ACGCGTGGGTCGCCGCCGCCTCCAGAGACGCCCATCGCCGAGCCCGGCACGGTGCCTGGCGGTGGCATCGAGGCC
CGATACGCCGCCTCGGGCATTTCCGGCACCGCAACCCTCAACAGCCTGCAGGCACACCAGGCGCAGAGCGCGGCC
GCCTCACAGAGGCTGCCGCAGTTCGGCAATCAGCCTCCTCAGCCTCAGCGCCCCTGGACGCCCACTGAGTCTCCG
GGCCAAGCCCCCTCGGGCCCTCCAACCGTTTATCAAGGGACGACCCCCATCTCGAGCTCGGGGGTACGGCTGACA
TTCAGTCCGCCTCCCGACCAGCCAGTGCCCAAGGATGGGAATCCGGCACTCCAGGTCAGCGTCTTGGAGCAGGAC
TTTCAACGCATGGGCACCAAGACGCCTCCCCCCGCTTATTCCAAGGTCAACCCCAACGGGGGCTCCCCCGGTGCG
AGGGAGAAGCAGCGCCCTCAGCAACGAACCTCCGGCCCCGACACGTCGCACGACGGCTCAACATCTTCTCCACCG
AGCAAGCCCGTCGCCGCCTCCGCCATGCCGGCCACGGCGCTGGCCTCTCCCGCGCTCCAGCACCCCGGGCATCCC
GCCTTCGCAAACGACCCTCGACCGGAGGCAAATGGCCAAGCTTTGGAAGTTGTCTCGACGGCCTCGCCTCCAGCA
CAGACGCCCGCTTCGCCGCCCCCGTTGCCCGAGGGCTGGATCGCTCACCTAGACCAGAACTCGGGGCAGTACTAC
TACATCCATCTTGCGTCGCAGGCTACGCAGTGGGAGTTCCCCAAGGGTCCCAACCCCATACAACACGAGCAGACG
CCCCTGTCGCCCACGGCTTCGACGTACGGAAACCCCCTGACGTCCCCCATGTTTGGCAAGCAGCCCATGGCGTCG
CCCATGTTCGCTCCTCACACACCGGGAGGGTATGCCGAGAGCATCATGAGCGTCGCGGCCTCGCAGGCGCCTTCA
GCCGCCGGTTTCTCAGGCCCCCCGCCCAGCTCGGGCGTCAGTATGTACAGGGTCCAGCCCACCAACGGCGTCTAC
TTTGGCCCTTACTTGAGATATGTCAACATGGATGTCGAAAAGGGAACTTGGTATGGAAGCATAATGATTGTGACG
GATGCACCACAGCCGCCGACTATTCACATCCACTTGAGCGTCGATCTCTCGCCCAATCCGAGGCAATTGCAACCC
CATGTCATCTATACGCACCAGCGCTGGACCTTTTACCGGTACGAAGTGGACCTGCAAATGGGCGAAGGTGGCACG
GAGAGATGGACCTACGCCGTCACGTCTCATTTGGGTTGCACGCGGTACGAATTCGTCGTGGCCGGCCGACACGAG
ACGGGATGGCGCTTCATCGCCCACTCCGGAAACGACTTCGCCTCCAACACGTCGCAGAACGAGAGGGCCAGGCTC
GGCGGCGTGGGCTTCATGTGGAAGGATGTGCTGCAGAAGAACATCGACTGCGGCGGCTTCCACGCCCAGCTCGGT
CTGGGCAGCCAGATCTACGCCGACCGGCTGTGGAAGGAGGTGCCCCTGCTGAAGCAATGGCTGGCCATGAGCGGC
AGAGACAACAAGAAGAACACGCAGTGGACGGCACGGCACGAGGAGGACGTGACGCACGCCTACTTTCACTTTTAC
ACGAGCCACTTTGACCAGCCCTTTTTGAGGGAGGCGTTCGCGCAGATCCCGCACGTACTGCAGATCAACGACCAC
GATATCTTCGACGGATACGGGTCTTATCCCCCTTACATGCAGGCATGGCCCATGTTCAAGAACATTGGGCGCATC
GCCACGGACATGTACCTCCTGTTTCAGCACCACACGACAGTGGAGATTATGCGGAACGTCAGTACGGACCTAGAC
ATCTTCACCGTCACCGGCGCCGGCTGGCATTTTGTCAAGTTCTTGGGGCCGGCCGTGGCCGTAGTCGGGGCCGAC
TGCCGATCCGAGAGGACTCAGGCCCGCGTTCTGGCCGGGCCGACGTATCAGGGCATTTTCCCCCGGGTGGCGATG
CTACCGCCCAGCGTCCAGCACGTCATCTGGATGATATCGGTGCCCATCATCTACCCGAGGCTGGACACGGTCGAG
AGCCTGGCCAACACCGTGGCGGCGGGAAAGAAGGCGGTCAACACGACGTACAACATTCTCGGCAAGGTGACGAGC
TCCATGGCTGGCGTGGTAGGCGGCAAGGAAGTCGTCGCCCAGGGCTTCACGCATGTCAAGAAGGCCGTGGGCAAA
ACCGGCTTGATGGGCAACGTCTTGAATCAATTTGGCGAGCTTGACATCCACGAGATTCTCAAGGACATGTGGACG
CACGACAGCAAGGACCTGGAACGGACCTATCTCATCCGTACTCTGCAGGGCATCGCCCAGCAAAAGGGTATCCGA
ATGACCTTTCTCTCCGGGGACGTCAACGCCTCAGGGGCCGGCCTCGTGCATGACCCCACGCACCCCGGCGATCAC
AAGACCATGTACCAGATCATCTCGTCGCCCATGGTAGGGGCACCGCAGGGCGGCTACGTCTCCAAGCTGTTGCAC
AACCAGAAGACGCTTTACGTGCCGTTGAACGGCCAGCGGTCGACGCACGAGGTGTCGGACACCAAGGAGGACATG
ATGGAGATTTTCCACACCGACGCCAGCGGCGCCTCGCGCGAACTGAAGAAGCTCATGAACCGGCGCAACTACGTC
ACCTTTTTCGCCTTTGACCAGGAGGCGGCGAGCCATCCGGCGCCGTTCAGCTCGGGATCGAGCATGAGCGACCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAACAAGTAGTACTACAGCAGCAGCAGCAGCAGCAGCAG
GGCCTCTCCAGGCTGGGCCTGGCCGTGGACTTTGTTGTGCAGGGAGACGGCGCGTACCAGGCGACTACCAAGTAC
GGGCCCGTCGTCATTCCGCATCTCGAGTACGGGAGA
Transcript >Ophio5|2706
ATGGCGGCGACTCGGAGCGTGCCCGAGGAGGAAATGTTCCTCAGCAAGCCCGCACCCGCCGATAGCCCTACTGTC
CGGCCTCTGCGTATCTTCAAGTCTCAGAGCCCCGGACCTGTCGTTCGCACTGATCCATCCGCTTCACTACCCAGC
TTCCCGCTGCCGCCGGGTGCCTCCAGCTCCGCGGCCCCGCTACCGTTCCCCGATGACGATTACATCTGCAAGCCG
GCTCACGCAAAGCCTTTCAACTCGCCCTGCAACGATACGAGCCCTCGGATAGACACTAACGTACCGCAGAAGCGG
CCGGGCCTTGCCGAGCGGAGGGGAGCGTCGCCCAAAGTCATCCACTCCCCCTCCAGCCCCGACGCTGATCCCCAA
TACTTTCCAAGGCCACTCAAGGAACAGGCGCTGCCCGCGTCTTCCCAATCGGGTCGTCTATACCCACAGAATAAG
ACATATTACCCTCCGCCGGCTGCCGGACCGCCGCTCTGGTCCGTGCCCGACAGCGGCCCGCATCCCCGACTATCC
GACCAGCACTTGAAGACGGACGAGCAGTGTGTGAACCGCTTCGCTTCGACGGCCTCCAACTACACGACCAAGGCA
ACGCGTGGGTCGCCGCCGCCTCCAGAGACGCCCATCGCCGAGCCCGGCACGGTGCCTGGCGGTGGCATCGAGGCC
CGATACGCCGCCTCGGGCATTTCCGGCACCGCAACCCTCAACAGCCTGCAGGCACACCAGGCGCAGAGCGCGGCC
GCCTCACAGAGGCTGCCGCAGTTCGGCAATCAGCCTCCTCAGCCTCAGCGCCCCTGGACGCCCACTGAGTCTCCG
GGCCAAGCCCCCTCGGGCCCTCCAACCGTTTATCAAGGGACGACCCCCATCTCGAGCTCGGGGGTACGGCTGACA
TTCAGTCCGCCTCCCGACCAGCCAGTGCCCAAGGATGGGAATCCGGCACTCCAGGTCAGCGTCTTGGAGCAGGAC
TTTCAACGCATGGGCACCAAGACGCCTCCCCCCGCTTATTCCAAGGTCAACCCCAACGGGGGCTCCCCCGGTGCG
AGGGAGAAGCAGCGCCCTCAGCAACGAACCTCCGGCCCCGACACGTCGCACGACGGCTCAACATCTTCTCCACCG
AGCAAGCCCGTCGCCGCCTCCGCCATGCCGGCCACGGCGCTGGCCTCTCCCGCGCTCCAGCACCCCGGGCATCCC
GCCTTCGCAAACGACCCTCGACCGGAGGCAAATGGCCAAGCTTTGGAAGTTGTCTCGACGGCCTCGCCTCCAGCA
CAGACGCCCGCTTCGCCGCCCCCGTTGCCCGAGGGCTGGATCGCTCACCTAGACCAGAACTCGGGGCAGTACTAC
TACATCCATCTTGCGTCGCAGGCTACGCAGTGGGAGTTCCCCAAGGGTCCCAACCCCATACAACACGAGCAGACG
CCCCTGTCGCCCACGGCTTCGACGTACGGAAACCCCCTGACGTCCCCCATGTTTGGCAAGCAGCCCATGGCGTCG
CCCATGTTCGCTCCTCACACACCGGGAGGGTATGCCGAGAGCATCATGAGCGTCGCGGCCTCGCAGGCGCCTTCA
GCCGCCGGTTTCTCAGGCCCCCCGCCCAGCTCGGGCGTCAGTATGTACAGGGTCCAGCCCACCAACGGCGTCTAC
TTTGGCCCTTACTTGAGATATGTCAACATGGATGTCGAAAAGGGAACTTGGTATGGAAGCATAATGATTGTGACG
GATGCACCACAGCCGCCGACTATTCACATCCACTTGAGCGTCGATCTCTCGCCCAATCCGAGGCAATTGCAACCC
CATGTCATCTATACGCACCAGCGCTGGACCTTTTACCGGTACGAAGTGGACCTGCAAATGGGCGAAGGTGGCACG
GAGAGATGGACCTACGCCGTCACGTCTCATTTGGGTTGCACGCGGTACGAATTCGTCGTGGCCGGCCGACACGAG
ACGGGATGGCGCTTCATCGCCCACTCCGGAAACGACTTCGCCTCCAACACGTCGCAGAACGAGAGGGCCAGGCTC
GGCGGCGTGGGCTTCATGTGGAAGGATGTGCTGCAGAAGAACATCGACTGCGGCGGCTTCCACGCCCAGCTCGGT
CTGGGCAGCCAGATCTACGCCGACCGGCTGTGGAAGGAGGTGCCCCTGCTGAAGCAATGGCTGGCCATGAGCGGC
AGAGACAACAAGAAGAACACGCAGTGGACGGCACGGCACGAGGAGGACGTGACGCACGCCTACTTTCACTTTTAC
ACGAGCCACTTTGACCAGCCCTTTTTGAGGGAGGCGTTCGCGCAGATCCCGCACGTACTGCAGATCAACGACCAC
GATATCTTCGACGGATACGGGTCTTATCCCCCTTACATGCAGGCATGGCCCATGTTCAAGAACATTGGGCGCATC
GCCACGGACATGTACCTCCTGTTTCAGCACCACACGACAGTGGAGATTATGCGGAACGTCAGTACGGACCTAGAC
ATCTTCACCGTCACCGGCGCCGGCTGGCATTTTGTCAAGTTCTTGGGGCCGGCCGTGGCCGTAGTCGGGGCCGAC
TGCCGATCCGAGAGGACTCAGGCCCGCGTTCTGGCCGGGCCGACGTATCAGGGCATTTTCCCCCGGGTGGCGATG
CTACCGCCCAGCGTCCAGCACGTCATCTGGATGATATCGGTGCCCATCATCTACCCGAGGCTGGACACGGTCGAG
AGCCTGGCCAACACCGTGGCGGCGGGAAAGAAGGCGGTCAACACGACGTACAACATTCTCGGCAAGGTGACGAGC
TCCATGGCTGGCGTGGTAGGCGGCAAGGAAGTCGTCGCCCAGGGCTTCACGCATGTCAAGAAGGCCGTGGGCAAA
ACCGGCTTGATGGGCAACGTCTTGAATCAATTTGGCGAGCTTGACATCCACGAGATTCTCAAGGACATGTGGACG
CACGACAGCAAGGACCTGGAACGGACCTATCTCATCCGTACTCTGCAGGGCATCGCCCAGCAAAAGGGTATCCGA
ATGACCTTTCTCTCCGGGGACGTCAACGCCTCAGGGGCCGGCCTCGTGCATGACCCCACGCACCCCGGCGATCAC
AAGACCATGTACCAGATCATCTCGTCGCCCATGGTAGGGGCACCGCAGGGCGGCTACGTCTCCAAGCTGTTGCAC
AACCAGAAGACGCTTTACGTGCCGTTGAACGGCCAGCGGTCGACGCACGAGGTGTCGGACACCAAGGAGGACATG
ATGGAGATTTTCCACACCGACGCCAGCGGCGCCTCGCGCGAACTGAAGAAGCTCATGAACCGGCGCAACTACGTC
ACCTTTTTCGCCTTTGACCAGGAGGCGGCGAGCCATCCGGCGCCGTTCAGCTCGGGATCGAGCATGAGCGACCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAACAAGTAGTACTACAGCAGCAGCAGCAGCAGCAGCAG
GGCCTCTCCAGGCTGGGCCTGGCCGTGGACTTTGTTGTGCAGGGAGACGGCGCGTACCAGGCGACTACCAAGTAC
GGGCCCGTCGTCATTCCGCATCTCGAGTACGGGAGATGA
Gene >Ophio5|2706
ATGGCGGCGACTCGGAGCGTGCCCGAGGAGGAAATGTTCCTCAGCAAGCCCGCACCCGCCGATAGCCCTACTGTC
CGGCCTCTGCGTATCTTCAAGTCTCAGAGCCCCGGACCTGTCGTTCGCACTGATCCATCCGCTTCACTACCCAGC
TTCCCGCTGCCGCCGGGTGCCTCCAGCTCCGCGGCCCCGCTACCGTTCCCCGATGACGATTACATCTGCAAGCCG
GCTCACGCAAAGCCTTTCAACTCGCCCTGCAACGATACGAGCCCTCGGATAGACACTAACGTACCGCAGAAGCGG
CCGGGCCTTGCCGAGCGGAGGGGAGCGTCGCCCAAAGTCATCCACTCCCCCTCCAGCCCCGACGCTGATCCCCAA
TACTTTCCAAGGCCACTCAAGGAACAGGCGCTGCCCGCGTCTTCCCAATCGGGTCGTCTATACCCACAGAATAAG
ACATATTACCCTCCGCCGGCTGCCGGACCGCCGCTCTGGTCCGTGCCCGACAGCGGCCCGCATCCCCGACTATCC
GACCAGCACTTGAAGACGGACGAGCAGTGTGTGAACCGCTTCGCTTCGACGGCCTCCAACTACACGACCAAGGCA
ACGCGTGGGTCGCCGCCGCCTCCAGAGACGCCCATCGCCGAGCCCGGCACGGTGCCTGGCGGTGGCATCGAGGCC
CGATACGCCGCCTCGGGCATTTCCGGCACCGCAACCCTCAACAGCCTGCAGGCACACCAGGCGCAGAGCGCGGCC
GCCTCACAGAGGCTGCCGCAGTTCGGCAATCAGCCTCCTCAGCCTCAGCGCCCCTGGACGCCCACTGAGTCTCCG
GGCCAAGCCCCCTCGGGCCCTCCAACCGTTTATCAAGGGACGACCCCCATCTCGAGCTCGGGGGTACGGCTGACA
TTCAGTCCGCCTCCCGACCAGCCAGTGCCCAAGGATGGGAATCCGGCACTCCAGGTCAGCGTCTTGGAGCAGGAC
TTTCAACGCATGGGCACCAAGACGCCTCCCCCCGCTTATTCCAAGGTCAACCCCAACGGGGGCTCCCCCGGTGCG
AGGGAGAAGCAGCGCCCTCAGCAACGAACCTCCGGCCCCGACACGTCGCACGACGGCTCAACATCTTCTCCACCG
AGCAAGCCCGTCGCCGCCTCCGCCATGCCGGCCACGGCGCTGGCCTCTCCCGCGCTCCAGCACCCCGGGCATCCC
GCCTTCGCAAACGACCCTCGACCGGAGGCAAATGGCCAAGCTTTGGAAGTTGTCTCGACGGCCTCGCCTCCAGCA
CAGACGCCCGCTTCGCCGCCCCCGTTGCCCGAGGGCTGGATCGCTCACCTAGACCAGAACTCGGGGCAGTACTAC
TACATCCATCTTGCGTCGCAGGCTACGCAGTGGGAGTTCCCCAAGGGTCCCAACCCCATACAACACGAGCAGACG
CCCCTGTCGCCCACGGCTTCGACGTACGGAAACCCCCTGACGTCCCCCATGTTTGGCAAGCAGCCCATGGCGTCG
CCCATGTTCGCTCCTCACACACCGGGAGGGTATGCCGAGAGCATCATGAGCGTCGCGGCCTCGCAGGCGCCTTCA
GCCGCCGGTTTCTCAGGCCCCCCGCCCAGCTCGGGCGTCAGTATGTACAGGGTCCAGCCCACCAACGGCGTCTAC
TTTGGCCCTTACTTGAGATATGTCAACATGGATGTCGAAAAGGGAACTTGGTATGGAAGCATAATGATTGTGACG
GATGCACCACAGCCGCCGACTATTCACATCCACTTGAGCGTCGATCTCTCGCCCAATCCGAGGCAATTGCAACCC
CATGTCATCTATACGCACCAGCGCTGGACCTTTTACCGGTACGAAGTGGACCTGCAAATGGGCGAAGGTGGCACG
GAGAGATGGACCTACGCCGTCACGTCTCATTTGGGTTGCACGCGGTACGAATTCGTCGTGGCCGGCCGACACGAG
ACGGGATGGCGCTTCATCGCCCACTCCGGAAACGACTTCGCCTCCAACACGTCGCAGAACGAGAGGGCCAGGCTC
GGCGGCGTGGGCTTCATGTGGAAGGATGTGCTGCAGAAGAACATCGACTGCGGCGGCTTCCACGCCCAGCTCGGT
CTGGGCAGCCAGATCTACGCCGACCGGCTGTGGAAGGAGGTGCCCCTGCTGAAGCAATGGCTGGCCATGAGCGGC
AGAGACAACAAGAAGAACACGCAGTGGACGGCACGGCACGAGGAGGACGTGACGCACGCCTACTTTCACTTTTAC
ACGAGCCACTTTGACCAGCCCTTTTTGAGGGAGGCGTTCGCGCAGATCCCGCACGTACTGCAGATCAACGACCAC
GATATGTAGGTGTTTCACGGACCGGGCCGAGCGTGTGGGTGGTGGTGGTGGTGGCGGTGGTGGTGTAGTGTATTG
ACTTGACGGCTAGCTTCGACGGATACGGGTCTTATCCCCCTTACATGCAGGCATGGCCCATGTTCAAGAACATTG
GGCGCATCGCCACGGACATGTACCTCCTGTTTCAGCACCACACGACAGTGGAGATTATGCGGAACGTCAGTACGG
ACCTAGACATCTTCACCGTCACCGGCGCCGGCTGGCATTTTGTCAAGTTCTTGGGGCCGGCCGTGGCCGTAGTCG
GGGCCGACTGCCGATCCGAGAGGACTCAGGCCCGCGTTCTGGCCGGGCCGACGTATCAGGGCATTTTCCCCCGGG
TGGCGATGCTACCGCCCAGCGTCCAGCACGTCATCTGGATGATATCGGTGCCCATCATCTACCCGAGGCTGGACA
CGGTCGAGAGCCTGGCCAACACCGTGGCGGCGGGAAAGAAGGCGGTCAACACGACGTACAACATTCTCGGCAAGG
TGACGAGCTCCATGGCTGGCGTGGTAGGCGGCAAGGAAGTCGTCGCCCAGGGCTTCACGCATGTCAAGAAGGCCG
TGGGCAAAACCGGCTTGATGGGCAACGTCTTGAATCAATTTGGCGAGCTTGACATCCACGAGATTCTCAAGGACA
TGTGGACGCACGACAGCAAGGACCTGGAACGGACCTATCTCATCCGTACTCTGCAGGGCATCGCCCAGCAAAAGG
GTATCCGAATGACCTTTCTCTCCGGGGGTGCGTATCCATCCGCCTCGGGCCTGGTCATGGTGAGCTTTGCTGACG
GACACGGCAGACGTCAACGCCTCAGGGGCCGGCCTCGTGCATGACCCCACGCACCCCGGCGATCACAAGACCATG
TACCAGATCATCTCGTCGCCCATGGTAGGGGCACCGCAGGGCGGCTACGTCTCCAAGCTGTTGCACAACCAGAAG
ACGCTTTACGTGCCGTTGAACGGCCAGCGGTCGACGCACGAGGTGTCGGACACCAAGGAGGACATGATGGAGATT
TTCCACACCGACGCCAGCGGCGCCTCGCGCGAACTGAAGAAGCTCATGAACCGGCGCAACTACGTCACCTTTTTC
GCCTTTGACCAGGAGGCGGCGAGCCATCCGGCGCCGTTCAGCTCGGGATCGAGCATGAGCGACCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAACAGCAGCAGCAACAAGTAGTACTACAGCAGCAGCAGCAGCAGCAGCAGGGCCTCTCC
AGGCTGGGCCTGGCCGTGGACTTTGTTGTGCAGGGAGACGGCGCGTACCAGGCGACTACCAAGTACGGGCCCGTC
GTCATTCCGCATCTCGAGTACGGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail