Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2704
Gene name
Locationscaffold_219:10149..12131
Strand+
Gene length (bp)1982
Transcript length (bp)1710
Coding sequence length (bp)1707
Protein length (aa) 569

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3433 0.9555 0.0066 0.013 0.0545 0.0061 0.0246 0.0088 0.0173 0.0042

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1427
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5457
Ophiocordyceps australis map64 (Brazil) OphauB2|3007
Ophiocordyceps camponoti-floridani Ophcf2|07142
Ophiocordyceps camponoti-rufipedis Ophun1|7107
Ophiocordyceps kimflemingae Ophio5|2704 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1093

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2704
MASLATTRGCTPGTAIKQIPLLCTVCPEAPRFSDVSHLLTHIASKGHLHHETQTRLKSHQDLTAHVVLQQYEQWY
KDNGIEALLVERMRTKQLKEAAKTRRSRGAAPLPSLNPKRKTKRPPSSTIIKSENDDFAQDFPLFPGFFASENDV
DIQDDFFVGNDMLSLKGQVWPGMGKMDLANEDMKRTRNQRKPNSVIEKMRRTSEGIEPTQVVMTSDLEVERIKGV
YDSSSPIPGQGEETPKKTSRPKRKRPDVLAEISANVPRGGVRRSSRNTLAKANRGQHLKLDYDRDTSSDQTPSLG
SFRHGHDLFQDDDGSSSGIFEDRTFSTPAHQDQKYDSRDRLALHSLNPISHSNVASPTPSTRDMPTRLLPVRDSN
RGRNPTHGYLGHGGHMTLGSLAQSDATFGISDSPMYSSSARLPFTATNHFGALAQESFRLNPGHHQQPKHGDYSS
TTGDSLSSSSGSQFLTMSESNPLFSHDRLFLSSFGQQHASQPLSSLGFTPINRGRDNSLTAHDNERRASGPSIKT
EPQLCDGIDGSEAKQGPFGSGLWDPQPSENSLALPEDLGEELEI
Coding >Ophio5|2704
ATGGCGTCACTGGCCACCACCAGAGGCTGCACGCCCGGCACCGCGATCAAGCAAATACCCCTGCTTTGCACCGTC
TGCCCCGAGGCCCCGCGCTTCTCCGACGTTTCTCACTTGTTGACGCACATCGCCTCCAAAGGTCATCTTCACCAT
GAGACACAGACCAGGCTCAAGTCCCATCAGGATCTCACAGCCCACGTTGTCCTCCAGCAGTACGAGCAGTGGTAC
AAGGACAACGGCATCGAGGCCCTCCTGGTCGAACGCATGAGGACCAAGCAGTTGAAAGAGGCGGCCAAGACGAGA
CGGTCAAGGGGAGCTGCTCCCTTGCCTTCGCTCAATCCGAAGCGCAAGACGAAGCGGCCGCCCAGCTCCACCATC
ATCAAGTCCGAGAACGACGACTTCGCCCAAGATTTCCCCTTGTTCCCGGGCTTCTTCGCCTCGGAAAACGACGTC
GACATTCAAGACGACTTCTTTGTTGGCAACGATATGCTGTCGCTCAAGGGCCAGGTTTGGCCGGGCATGGGCAAG
ATGGACCTTGCCAATGAGGACATGAAGCGCACCCGCAACCAGCGCAAGCCAAACTCCGTCATTGAGAAGATGCGC
AGAACTTCTGAAGGAATCGAGCCAACTCAGGTGGTCATGACCTCTGATCTCGAGGTGGAGAGGATCAAAGGAGTG
TATGACAGCTCCTCCCCTATCCCCGGCCAGGGAGAAGAGACACCGAAAAAAACATCGAGGCCCAAGCGCAAGAGG
CCTGATGTGCTGGCGGAAATCTCTGCCAACGTTCCTCGAGGCGGAGTCCGCCGATCAAGCCGCAACACCTTGGCC
AAGGCCAACCGAGGGCAGCACCTCAAGCTGGACTACGACCGCGACACCAGTTCAGATCAAACGCCGTCTCTTGGA
TCCTTCAGACACGGCCACGATTTGTTTCAAGACGATGACGGATCCTCCTCGGGCATCTTCGAAGATCGCACATTC
TCTACGCCTGCACACCAAGATCAAAAGTACGACTCGAGGGACCGACTGGCGCTGCATTCCCTTAACCCCATATCC
CATTCGAATGTGGCGTCGCCCACTCCCTCCACGAGAGACATGCCCACTCGCCTCCTCCCCGTCCGAGACTCGAAT
CGAGGGAGAAACCCGACGCATGGATACCTTGGGCACGGCGGCCACATGACCTTGGGCTCTCTCGCACAATCGGAC
GCAACGTTTGGCATCAGCGATTCGCCCATGTATAGCAGCTCAGCGAGGCTCCCCTTCACCGCCACCAACCATTTT
GGCGCTCTCGCTCAGGAAAGCTTTCGCCTCAATCCTGGTCACCACCAGCAGCCCAAGCATGGAGACTATTCGTCC
ACGACGGGAGACTCGCTGTCCAGCTCGAGTGGTAGCCAATTCCTGACCATGTCCGAGTCAAACCCTCTCTTCTCT
CACGACCGTTTATTCCTCTCCTCTTTCGGCCAGCAGCACGCAAGCCAGCCTCTGTCATCTCTCGGATTCACGCCC
ATCAATCGAGGTCGAGACAATAGCCTTACGGCTCATGACAACGAGAGGCGGGCGTCTGGTCCCAGCATCAAGACC
GAGCCGCAACTTTGCGATGGCATCGACGGTAGCGAAGCGAAGCAAGGTCCCTTTGGCAGCGGCTTATGGGACCCG
CAGCCTTCGGAAAACAGCCTGGCTCTTCCCGAAGACCTTGGTGAAGAGTTGGAAATC
Transcript >Ophio5|2704
ATGGCGTCACTGGCCACCACCAGAGGCTGCACGCCCGGCACCGCGATCAAGCAAATACCCCTGCTTTGCACCGTC
TGCCCCGAGGCCCCGCGCTTCTCCGACGTTTCTCACTTGTTGACGCACATCGCCTCCAAAGGTCATCTTCACCAT
GAGACACAGACCAGGCTCAAGTCCCATCAGGATCTCACAGCCCACGTTGTCCTCCAGCAGTACGAGCAGTGGTAC
AAGGACAACGGCATCGAGGCCCTCCTGGTCGAACGCATGAGGACCAAGCAGTTGAAAGAGGCGGCCAAGACGAGA
CGGTCAAGGGGAGCTGCTCCCTTGCCTTCGCTCAATCCGAAGCGCAAGACGAAGCGGCCGCCCAGCTCCACCATC
ATCAAGTCCGAGAACGACGACTTCGCCCAAGATTTCCCCTTGTTCCCGGGCTTCTTCGCCTCGGAAAACGACGTC
GACATTCAAGACGACTTCTTTGTTGGCAACGATATGCTGTCGCTCAAGGGCCAGGTTTGGCCGGGCATGGGCAAG
ATGGACCTTGCCAATGAGGACATGAAGCGCACCCGCAACCAGCGCAAGCCAAACTCCGTCATTGAGAAGATGCGC
AGAACTTCTGAAGGAATCGAGCCAACTCAGGTGGTCATGACCTCTGATCTCGAGGTGGAGAGGATCAAAGGAGTG
TATGACAGCTCCTCCCCTATCCCCGGCCAGGGAGAAGAGACACCGAAAAAAACATCGAGGCCCAAGCGCAAGAGG
CCTGATGTGCTGGCGGAAATCTCTGCCAACGTTCCTCGAGGCGGAGTCCGCCGATCAAGCCGCAACACCTTGGCC
AAGGCCAACCGAGGGCAGCACCTCAAGCTGGACTACGACCGCGACACCAGTTCAGATCAAACGCCGTCTCTTGGA
TCCTTCAGACACGGCCACGATTTGTTTCAAGACGATGACGGATCCTCCTCGGGCATCTTCGAAGATCGCACATTC
TCTACGCCTGCACACCAAGATCAAAAGTACGACTCGAGGGACCGACTGGCGCTGCATTCCCTTAACCCCATATCC
CATTCGAATGTGGCGTCGCCCACTCCCTCCACGAGAGACATGCCCACTCGCCTCCTCCCCGTCCGAGACTCGAAT
CGAGGGAGAAACCCGACGCATGGATACCTTGGGCACGGCGGCCACATGACCTTGGGCTCTCTCGCACAATCGGAC
GCAACGTTTGGCATCAGCGATTCGCCCATGTATAGCAGCTCAGCGAGGCTCCCCTTCACCGCCACCAACCATTTT
GGCGCTCTCGCTCAGGAAAGCTTTCGCCTCAATCCTGGTCACCACCAGCAGCCCAAGCATGGAGACTATTCGTCC
ACGACGGGAGACTCGCTGTCCAGCTCGAGTGGTAGCCAATTCCTGACCATGTCCGAGTCAAACCCTCTCTTCTCT
CACGACCGTTTATTCCTCTCCTCTTTCGGCCAGCAGCACGCAAGCCAGCCTCTGTCATCTCTCGGATTCACGCCC
ATCAATCGAGGTCGAGACAATAGCCTTACGGCTCATGACAACGAGAGGCGGGCGTCTGGTCCCAGCATCAAGACC
GAGCCGCAACTTTGCGATGGCATCGACGGTAGCGAAGCGAAGCAAGGTCCCTTTGGCAGCGGCTTATGGGACCCG
CAGCCTTCGGAAAACAGCCTGGCTCTTCCCGAAGACCTTGGTGAAGAGTTGGAAATCTGA
Gene >Ophio5|2704
ATGGCGTCACTGGCCACCACCAGAGGCTGCACGCCCGGCACCGCGATCAAGCAAATACCCCTGCTTTGCACCGTC
TGCCCCGAGGCCCCGCGCTTCTCCGACGTTTCTCACTTGTTGACGCACATCGCCTCCAAAGGTCATCTTCACCAT
GAGACACAGACCAGGCTCAAGTCCCATCAGGATCTCACAGCCCACGTTGTCCTCCAGCAGTACGAGCAGTGGTAC
AAGGACAACGGCATCGAGGCCCTCCTGGTCGAACGCATGAGGACCAAGCAGTTGAAAGAGGCGGCCAAGACGAGA
CGGTCAAGGGGAGCTGCTCCCTTGCCTTCGCTCAATGTACGTTCCTCGCTTGCAAGGCCAGCGAAGTGATGCTGA
TGCTGGAAGCAGCCGAAGCGCAAGACGAAGCGGCCGCCCAGCTCCACCATCATCAAGTCCGAGAACGACGACTTC
GCCCAAGATTTCCCCTTGTTCCCGGGCTTCTTCGCCTCGGAAAACGACGTCGACATTCAAGACGACTTCTTTGTT
GGCAACGATATGCTGTCGCTCAAGGGCCAGGTTTGGCCGGGCATGGGCAAGATGGACCTTGCCAATGAGGACATG
AAGCGCACCCGCAACCAGCGCAAGCCAAACTCCGTCATTGAGAAGATGCGCAGAACTTCTGAAGGAATCGAGCCA
ACTCAGGTGGTCATGACCTCTGATCTCGAGGTGGAGAGGATCAAAGGAGTGTATGACAGCTCCTCCCCTATCCCC
GGCCAGGGAGAAGAGGTGAGAATCACCCTTTGCTTCGTCGGCGTCGAGCACGGCACTGATACTGGCAGACACCGA
AAAAAACATCGAGGCCCAAGCGCAAGAGGCCTGATGTGCTGGCGGAAATCTCTGCCAACGTTCCTCGAGGCGGAG
TCCGCCGATCAAGCCGCAACACCTTGGCCAAGGCCAACCGAGGGCAGCACCTCAAGCTGGACTACGACCGCGACA
CCAGTTCAGATCAAACGCCGTCTCTTGGATCCTTCAGACACGGCCACGATTTGTTTCAAGACGATGACGGATCCT
CCTCGGGTATGCCATTTTGTTACGCTCTCGACGCGGTGCTGACGGATGTAGGCATCTTCGAAGATCGCACATTCT
CTACGCCTGCACACCAAGATCAAAAGTACGAATGTAATCCGCCTCTGATGGGCACGTCCGTGAGCTCACGGTGCC
CCAGGTACGACTCGAGGGACCGACTGGCGCTGCATTCCCTTAACCCCATATCCCATTCGAATGTGGCGTCGCCCA
CTCCCTCCACGAGAGACATGCCCACTCGCCTCCTCCCCGTCCGAGACTCGAATCGAGGGAGAAACCCGACGCATG
GATACCTTGGGCACGGCGGCCACATGACCTTGGGTAAGTAGTTAAGTGCTTGCCCAGGGTGATTTTTTTTTTCTT
GAGGCGAAGAATCTGACAAGGCTCAAGGCTCTCTCGCACAATCGGACGCAACGTTTGGCATCAGCGATTCGCCCA
TGTATAGCAGCTCAGCGAGGCTCCCCTTCACCGCCACCAACCATTTTGGCGCTCTCGCTCAGGAAAGCTTTCGCC
TCAATCCTGGTCACCACCAGCAGCCCAAGCATGGAGACTATTCGTCCACGACGGGAGACTCGCTGTCCAGCTCGA
GTGGTAGCCAATTCCTGACCATGTCCGAGTCAAACCCTCTCTTCTCTCACGACCGTTTATTCCTCTCCTCTTTCG
GCCAGCAGCACGCAAGCCAGCCTCTGTCATCTCTCGGATTCACGCCCATCAATCGAGGTCGAGACAATAGCCTTA
CGGCTCATGACAACGAGAGGCGGGCGTCTGGTCCCAGCATCAAGACCGAGCCGCAACTTTGCGATGGCATCGACG
GTAGCGAAGCGAAGCAAGGTCCCTTTGGCAGCGGCTTATGGGACCCGCAGCCTTCGGAAAACAGCCTGGCTCTTC
CCGAAGACCTTGGTGAAGAGTTGGAAATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail