Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2695
Gene name
Locationscaffold_218:19855..21667
Strand-
Gene length (bp)1812
Transcript length (bp)1626
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00955 HCO3_cotransp HCO3- transporter family 7.8E-32 21 185
PF00955 HCO3_cotransp HCO3- transporter family 8.8E-39 191 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53838|BOR1_YEAST Boron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOR1 PE=1 SV=1 35 480 7.0E-70
sp|Q9HGM6|YHW5_SCHPO Putative transporter C543.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.05c PE=3 SV=1 26 511 5.0E-68
sp|Q3E954|BOR6_ARATH Probable boron transporter 6 OS=Arabidopsis thaliana GN=BOR6 PE=2 SV=2 16 512 2.0E-45
sp|Q8VYR7|BOR1_ARATH Boron transporter 1 OS=Arabidopsis thaliana GN=BOR1 PE=1 SV=1 17 511 4.0E-42
sp|Q9M1P7|BOR2_ARATH Probable boron transporter 2 OS=Arabidopsis thaliana GN=BOR2 PE=2 SV=1 17 512 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53838|BOR1_YEAST Boron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOR1 PE=1 SV=1 35 480 7.0E-70
sp|Q9HGM6|YHW5_SCHPO Putative transporter C543.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.05c PE=3 SV=1 26 511 5.0E-68
sp|Q3E954|BOR6_ARATH Probable boron transporter 6 OS=Arabidopsis thaliana GN=BOR6 PE=2 SV=2 16 512 2.0E-45
sp|Q8VYR7|BOR1_ARATH Boron transporter 1 OS=Arabidopsis thaliana GN=BOR1 PE=1 SV=1 17 511 4.0E-42
sp|Q9M1P7|BOR2_ARATH Probable boron transporter 2 OS=Arabidopsis thaliana GN=BOR2 PE=2 SV=1 17 512 1.0E-40
sp|Q93Z13|BOR3_ARATH Probable boron transporter 3 OS=Arabidopsis thaliana GN=BOR3 PE=1 SV=1 17 511 5.0E-39
sp|P04919|B3AT_MOUSE Band 3 anion transport protein OS=Mus musculus GN=Slc4a1 PE=1 SV=1 5 512 2.0E-35
sp|Q9SSG5|BOR5_ARATH Putative boron transporter 5 OS=Arabidopsis thaliana GN=BOR5 PE=3 SV=1 16 390 3.0E-35
sp|Q9XI23|BOR4_ARATH Boron transporter 4 OS=Arabidopsis thaliana GN=BOR4 PE=2 SV=1 46 361 7.0E-35
sp|P04920|B3A2_HUMAN Anion exchange protein 2 OS=Homo sapiens GN=SLC4A2 PE=1 SV=4 17 511 1.0E-33
sp|P23347|B3A2_RAT Anion exchange protein 2 OS=Rattus norvegicus GN=Slc4a2 PE=1 SV=1 17 512 2.0E-33
sp|Q9SUU1|BOR7_ARATH Probable boron transporter 7 OS=Arabidopsis thaliana GN=BOR7 PE=2 SV=3 16 372 3.0E-33
sp|P13808|B3A2_MOUSE Anion exchange protein 2 OS=Mus musculus GN=Slc4a2 PE=1 SV=1 17 512 9.0E-33
sp|Q5RD44|B3A2_PONAB Anion exchange protein 2 OS=Pongo abelii GN=SLC4A2 PE=2 SV=2 17 511 2.0E-32
sp|P48746|B3A2_RABIT Anion exchange protein 2 OS=Oryctolagus cuniculus GN=SLC4A2 PE=2 SV=1 17 511 2.0E-32
sp|Q6SJP2|B3A2_HORSE Anion exchange protein 2 OS=Equus caballus GN=SLC4A2 PE=2 SV=1 17 511 3.0E-32
sp|P23562|B3AT_RAT Band 3 anion transport protein OS=Rattus norvegicus GN=Slc4a1 PE=1 SV=3 6 512 3.0E-32
sp|P15575|B3AT_CHICK Band 3 anion transport protein OS=Gallus gallus GN=SLC4A1 PE=2 SV=1 3 511 6.0E-32
sp|P02730|B3AT_HUMAN Band 3 anion transport protein OS=Homo sapiens GN=SLC4A1 PE=1 SV=3 29 535 5.0E-31
sp|O18917|B3A3_RABIT Anion exchange protein 3 OS=Oryctolagus cuniculus GN=SLC4A3 PE=2 SV=1 3 525 4.0E-30
sp|P23348|B3A3_RAT Anion exchange protein 3 OS=Rattus norvegicus GN=Slc4a3 PE=1 SV=1 35 525 4.0E-30
sp|P48751|B3A3_HUMAN Anion exchange protein 3 OS=Homo sapiens GN=SLC4A3 PE=2 SV=2 35 525 5.0E-30
sp|B1MTL0|B3A3_CALMO Anion exchange protein 3 OS=Callicebus moloch GN=SLC4A3 PE=3 SV=1 35 525 5.0E-30
sp|Q9Z0S8|B3A2_CAVPO Anion exchange protein 2 OS=Cavia porcellus GN=SLC4A2 PE=2 SV=1 1 511 6.0E-30
sp|P16283|B3A3_MOUSE Anion exchange protein 3 OS=Mus musculus GN=Slc4a3 PE=1 SV=2 35 525 3.0E-29
sp|Q5RB85|B3A3_PONAB Anion exchange protein 3 OS=Pongo abelii GN=SLC4A3 PE=2 SV=1 3 525 4.0E-29
sp|P32847|B3AT_ONCMY Band 3 anion exchange protein OS=Oncorhynchus mykiss GN=slc4a1 PE=2 SV=2 7 538 4.0E-29
sp|O13134|S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum GN=SLC4A4 PE=2 SV=1 205 511 7.0E-23
sp|Q6RI88|S4A5_RAT Electrogenic sodium bicarbonate cotransporter 4 OS=Rattus norvegicus GN=Slc4a5 PE=1 SV=1 226 538 4.0E-22
sp|Q8NBS3|S4A11_HUMAN Sodium bicarbonate transporter-like protein 11 OS=Homo sapiens GN=SLC4A11 PE=1 SV=2 13 512 8.0E-22
sp|Q9XSZ4|S4A4_RABIT Electrogenic sodium bicarbonate cotransporter 1 OS=Oryctolagus cuniculus GN=SLC4A4 PE=1 SV=1 227 511 2.0E-20
sp|Q6U841|S4A10_HUMAN Sodium-driven chloride bicarbonate exchanger OS=Homo sapiens GN=SLC4A10 PE=2 SV=1 258 537 2.0E-20
sp|Q4U116|S4A4_PIG Electrogenic sodium bicarbonate cotransporter 1 OS=Sus scrofa GN=SLC4A4 PE=1 SV=1 227 511 2.0E-20
sp|Q32LP4|S4A10_BOVIN Sodium-driven chloride bicarbonate exchanger OS=Bos taurus GN=SLC4A10 PE=2 SV=1 258 537 3.0E-20
sp|Q9BY07|S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens GN=SLC4A5 PE=2 SV=2 226 512 3.0E-20
sp|Q9Y6R1|S4A4_HUMAN Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens GN=SLC4A4 PE=1 SV=1 227 511 3.0E-20
sp|Q9GL77|S4A4_BOVIN Electrogenic sodium bicarbonate cotransporter 1 OS=Bos taurus GN=SLC4A4 PE=1 SV=1 248 511 4.0E-20
sp|Q80ZA5|S4A10_RAT Sodium-driven chloride bicarbonate exchanger OS=Rattus norvegicus GN=Slc4a10 PE=1 SV=1 258 537 4.0E-20
sp|Q5DTL9|S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus GN=Slc4a10 PE=1 SV=2 258 537 4.0E-20
sp|O88343|S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus GN=Slc4a4 PE=1 SV=2 227 511 1.0E-19
sp|Q9JI66|S4A4_RAT Electrogenic sodium bicarbonate cotransporter 1 OS=Rattus norvegicus GN=Slc4a4 PE=1 SV=1 227 511 5.0E-19
sp|Q9Y6M7|S4A7_HUMAN Sodium bicarbonate cotransporter 3 OS=Homo sapiens GN=SLC4A7 PE=1 SV=2 226 511 7.0E-18
sp|Q96Q91|B3A4_HUMAN Anion exchange protein 4 OS=Homo sapiens GN=SLC4A9 PE=2 SV=2 226 532 1.0E-17
sp|A2AJN7|S4A11_MOUSE Sodium bicarbonate transporter-like protein 11 OS=Mus musculus GN=Slc4a11 PE=2 SV=1 45 512 3.0E-17
sp|Q9R1N3|S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus GN=Slc4a7 PE=1 SV=1 226 511 6.0E-17
sp|Q8JZR6|S4A8_MOUSE Electroneutral sodium bicarbonate exchanger 1 OS=Mus musculus GN=Slc4a8 PE=2 SV=1 258 511 4.0E-16
sp|Q6RVG2|S4A8_RAT Electroneutral sodium bicarbonate exchanger 1 OS=Rattus norvegicus GN=Slc4a8 PE=1 SV=1 258 511 7.0E-16
sp|Q2Y0W8|S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens GN=SLC4A8 PE=1 SV=1 258 511 7.0E-16
sp|Q8K4V2|B3A4_RAT Anion exchange protein 4 OS=Rattus norvegicus GN=Slc4a9 PE=1 SV=1 207 532 2.0E-15
sp|Q9GKY1|B3A4_RABIT Anion exchange protein 4 OS=Oryctolagus cuniculus GN=SLC4A9 PE=1 SV=2 226 532 3.0E-14
sp|Q9Y6M7|S4A7_HUMAN Sodium bicarbonate cotransporter 3 OS=Homo sapiens GN=SLC4A7 PE=1 SV=2 7 183 3.0E-12
sp|Q9GKY1|B3A4_RABIT Anion exchange protein 4 OS=Oryctolagus cuniculus GN=SLC4A9 PE=1 SV=2 35 179 3.0E-12
sp|Q9R1N3|S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus GN=Slc4a7 PE=1 SV=1 30 183 4.0E-12
sp|Q6RI88|S4A5_RAT Electrogenic sodium bicarbonate cotransporter 4 OS=Rattus norvegicus GN=Slc4a5 PE=1 SV=1 17 183 5.0E-12
sp|Q8BTY2|S4A7_MOUSE Sodium bicarbonate cotransporter 3 OS=Mus musculus GN=Slc4a7 PE=1 SV=2 37 183 7.0E-12
sp|O88343|S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus GN=Slc4a4 PE=1 SV=2 39 179 8.0E-12
sp|Q8JZR6|S4A8_MOUSE Electroneutral sodium bicarbonate exchanger 1 OS=Mus musculus GN=Slc4a8 PE=2 SV=1 11 183 8.0E-12
sp|Q4U116|S4A4_PIG Electrogenic sodium bicarbonate cotransporter 1 OS=Sus scrofa GN=SLC4A4 PE=1 SV=1 39 179 2.0E-11
sp|Q9JI66|S4A4_RAT Electrogenic sodium bicarbonate cotransporter 1 OS=Rattus norvegicus GN=Slc4a4 PE=1 SV=1 39 179 2.0E-11
sp|Q9GL77|S4A4_BOVIN Electrogenic sodium bicarbonate cotransporter 1 OS=Bos taurus GN=SLC4A4 PE=1 SV=1 39 179 3.0E-11
sp|Q9XSZ4|S4A4_RABIT Electrogenic sodium bicarbonate cotransporter 1 OS=Oryctolagus cuniculus GN=SLC4A4 PE=1 SV=1 39 179 4.0E-11
sp|Q2Y0W8|S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens GN=SLC4A8 PE=1 SV=1 3 183 7.0E-11
sp|Q6RVG2|S4A8_RAT Electroneutral sodium bicarbonate exchanger 1 OS=Rattus norvegicus GN=Slc4a8 PE=1 SV=1 45 183 7.0E-11
sp|Q9BY07|S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens GN=SLC4A5 PE=2 SV=2 35 183 1.0E-10
sp|Q6U841|S4A10_HUMAN Sodium-driven chloride bicarbonate exchanger OS=Homo sapiens GN=SLC4A10 PE=2 SV=1 30 183 1.0E-10
sp|Q32LP4|S4A10_BOVIN Sodium-driven chloride bicarbonate exchanger OS=Bos taurus GN=SLC4A10 PE=2 SV=1 3 183 1.0E-10
sp|Q80ZA5|S4A10_RAT Sodium-driven chloride bicarbonate exchanger OS=Rattus norvegicus GN=Slc4a10 PE=1 SV=1 10 183 1.0E-10
sp|Q96Q91|B3A4_HUMAN Anion exchange protein 4 OS=Homo sapiens GN=SLC4A9 PE=2 SV=2 35 179 1.0E-10
sp|Q9Y6R1|S4A4_HUMAN Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens GN=SLC4A4 PE=1 SV=1 39 179 2.0E-10
sp|Q5DTL9|S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus GN=Slc4a10 PE=1 SV=2 30 183 2.0E-10
sp|Q8K4V2|B3A4_RAT Anion exchange protein 4 OS=Rattus norvegicus GN=Slc4a9 PE=1 SV=1 35 179 3.0E-10
sp|O13134|S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum GN=SLC4A4 PE=2 SV=1 39 179 4.0E-09
sp|Q9SSG5|BOR5_ARATH Putative boron transporter 5 OS=Arabidopsis thaliana GN=BOR5 PE=3 SV=1 369 512 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006820 anion transport Yes
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 81 103 22
3 129 151 22
4 158 176 18
5 191 213 22
6 226 248 22
7 281 303 22
8 323 345 22
9 386 408 22
10 413 435 22
11 469 491 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 9.18 3.48 14.88
CcL In ants, during behavior modification 18.87 7.59 30.16
CcD In ants, recently dead 4.26 1.21 7.31

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.016750 yes
SC16a CcD 0.022523 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2695
MTSPAGPTTGPAPKGGTFRPFRLLRTDGHNFLRRWPTDWREMNQQVVASAVYIFFTNLLPGITFASDLFELTGRS
WGPIEVVFSTGLCGVVFALFSAQPLTILGVTGPFSVLAENIYQLCETHFHIDFLPVMAWTLIHAGWMHLVLAIFN
AHDWTMRYVTHFSADIFSLLNSVIYFHKAALELRRTHAAVSLAAFLYAVIGAVGTCIVAVFLSTANSWRPLLHRY
LRLGLAEYAASISIVLWIGIPHIGELNSLDHQRLQVQSELRPSAPDRAVFLVRFWTLPVAWVFLAIIPAAIVTVL
FFFDHEISSIICTASRYRVRKPGGFAWDVALLGLTTLLCGILGLPPANGLLPQAPLHSESLLHHEKTTSRHDDGD
SQPRTYEQRYSALIQSALILAFISPPLQRLLGLTQTSVLAGLFMFMGYQSLAVNPILYRVAHLLTPPSELPPLPQ
AVSWLAVHGFTLTQIALTGAVFAMTLTVAAPAFPLVIIALVPVRLTLMGRIWSRETLRFVDGWACRQGKPEDGES
GPEVQAEARPDEEKGP
Coding >Ophio5|2695
ATGACCTCGCCGGCCGGCCCCACCACCGGTCCGGCCCCGAAAGGCGGCACCTTCCGCCCGTTCCGCCTCCTCCGG
ACCGACGGCCACAACTTCCTCCGACGATGGCCGACGGATTGGAGAGAGATGAACCAGCAAGTCGTCGCCAGCGCC
GTGTACATCTTCTTCACCAATCTTCTTCCCGGCATCACTTTTGCCAGCGACCTGTTTGAGCTGACGGGTCGGTCG
TGGGGGCCCATTGAGGTTGTTTTCAGTACGGGGCTGTGCGGTGTCGTCTTTGCCTTATTCTCTGCTCAGCCGCTC
ACTATCCTCGGCGTGACGGGCCCCTTTTCCGTCTTGGCTGAGAACATCTACCAGTTATGCGAGACACATTTCCAT
ATCGACTTCCTCCCCGTCATGGCTTGGACCCTCATCCACGCCGGCTGGATGCACCTCGTCCTCGCCATCTTCAAC
GCCCACGATTGGACGATGCGCTACGTCACCCACTTCAGCGCCGACATCTTCTCCCTCCTCAACAGCGTCATCTAC
TTCCACAAGGCCGCTCTGGAGCTGCGGCGGACCCACGCCGCCGTCTCGCTCGCCGCTTTTCTTTATGCCGTCATC
GGCGCCGTCGGCACCTGTATCGTCGCCGTCTTTCTATCGACGGCCAATTCCTGGCGTCCGCTGTTGCATCGTTAT
CTGCGTTTGGGGCTGGCTGAGTATGCGGCTTCCATCTCCATCGTCCTTTGGATCGGCATCCCGCATATCGGCGAG
CTGAACTCGCTCGATCATCAGAGGCTGCAGGTTCAGTCCGAGCTTAGGCCTTCGGCGCCGGACCGTGCAGTCTTT
CTCGTCCGTTTCTGGACTCTGCCCGTTGCTTGGGTCTTTCTCGCCATCATTCCCGCTGCTATCGTCACCGTCCTC
TTCTTCTTCGACCATGAGATTAGCAGCATCATCTGTACTGCCTCCCGCTATCGTGTACGGAAACCCGGTGGCTTC
GCCTGGGATGTCGCTCTGCTCGGCCTCACCACCCTCCTGTGTGGCATCCTCGGCCTCCCGCCAGCCAACGGGTTA
CTGCCCCAGGCACCGCTGCATTCCGAGTCGTTACTACATCACGAAAAGACCACATCTCGCCATGATGATGGTGAC
AGCCAACCGCGGACATACGAGCAGCGGTACTCAGCCCTCATTCAATCCGCCCTCATCCTCGCCTTCATCTCGCCC
CCCCTCCAACGTCTCCTCGGCCTGACGCAAACCTCGGTCCTGGCCGGTCTCTTCATGTTCATGGGCTACCAATCC
CTCGCCGTCAACCCCATCCTCTACCGCGTCGCCCACCTCCTGACACCGCCCTCGGAGCTGCCTCCTCTTCCCCAA
GCCGTCTCCTGGCTCGCCGTCCACGGCTTCACATTGACGCAGATCGCCCTCACCGGCGCCGTCTTCGCCATGACG
CTCACCGTCGCCGCCCCGGCCTTTCCCCTCGTCATCATCGCCCTCGTGCCCGTCCGGCTCACGCTCATGGGCCGC
ATCTGGTCCCGCGAGACGTTGCGCTTCGTCGACGGCTGGGCCTGTCGCCAGGGGAAGCCCGAGGACGGCGAGAGC
GGGCCCGAGGTCCAGGCCGAGGCTCGGCCCGACGAGGAAAAGGGTCCG
Transcript >Ophio5|2695
ATGACCTCGCCGGCCGGCCCCACCACCGGTCCGGCCCCGAAAGGCGGCACCTTCCGCCCGTTCCGCCTCCTCCGG
ACCGACGGCCACAACTTCCTCCGACGATGGCCGACGGATTGGAGAGAGATGAACCAGCAAGTCGTCGCCAGCGCC
GTGTACATCTTCTTCACCAATCTTCTTCCCGGCATCACTTTTGCCAGCGACCTGTTTGAGCTGACGGGTCGGTCG
TGGGGGCCCATTGAGGTTGTTTTCAGTACGGGGCTGTGCGGTGTCGTCTTTGCCTTATTCTCTGCTCAGCCGCTC
ACTATCCTCGGCGTGACGGGCCCCTTTTCCGTCTTGGCTGAGAACATCTACCAGTTATGCGAGACACATTTCCAT
ATCGACTTCCTCCCCGTCATGGCTTGGACCCTCATCCACGCCGGCTGGATGCACCTCGTCCTCGCCATCTTCAAC
GCCCACGATTGGACGATGCGCTACGTCACCCACTTCAGCGCCGACATCTTCTCCCTCCTCAACAGCGTCATCTAC
TTCCACAAGGCCGCTCTGGAGCTGCGGCGGACCCACGCCGCCGTCTCGCTCGCCGCTTTTCTTTATGCCGTCATC
GGCGCCGTCGGCACCTGTATCGTCGCCGTCTTTCTATCGACGGCCAATTCCTGGCGTCCGCTGTTGCATCGTTAT
CTGCGTTTGGGGCTGGCTGAGTATGCGGCTTCCATCTCCATCGTCCTTTGGATCGGCATCCCGCATATCGGCGAG
CTGAACTCGCTCGATCATCAGAGGCTGCAGGTTCAGTCCGAGCTTAGGCCTTCGGCGCCGGACCGTGCAGTCTTT
CTCGTCCGTTTCTGGACTCTGCCCGTTGCTTGGGTCTTTCTCGCCATCATTCCCGCTGCTATCGTCACCGTCCTC
TTCTTCTTCGACCATGAGATTAGCAGCATCATCTGTACTGCCTCCCGCTATCGTGTACGGAAACCCGGTGGCTTC
GCCTGGGATGTCGCTCTGCTCGGCCTCACCACCCTCCTGTGTGGCATCCTCGGCCTCCCGCCAGCCAACGGGTTA
CTGCCCCAGGCACCGCTGCATTCCGAGTCGTTACTACATCACGAAAAGACCACATCTCGCCATGATGATGGTGAC
AGCCAACCGCGGACATACGAGCAGCGGTACTCAGCCCTCATTCAATCCGCCCTCATCCTCGCCTTCATCTCGCCC
CCCCTCCAACGTCTCCTCGGCCTGACGCAAACCTCGGTCCTGGCCGGTCTCTTCATGTTCATGGGCTACCAATCC
CTCGCCGTCAACCCCATCCTCTACCGCGTCGCCCACCTCCTGACACCGCCCTCGGAGCTGCCTCCTCTTCCCCAA
GCCGTCTCCTGGCTCGCCGTCCACGGCTTCACATTGACGCAGATCGCCCTCACCGGCGCCGTCTTCGCCATGACG
CTCACCGTCGCCGCCCCGGCCTTTCCCCTCGTCATCATCGCCCTCGTGCCCGTCCGGCTCACGCTCATGGGCCGC
ATCTGGTCCCGCGAGACGTTGCGCTTCGTCGACGGCTGGGCCTGTCGCCAGGGGAAGCCCGAGGACGGCGAGAGC
GGGCCCGAGGTCCAGGCCGAGGCTCGGCCCGACGAGGAAAAGGGTCCGTGA
Gene >Ophio5|2695
ATGACCTCGCCGGCCGGCCCCACCACCGGTCCGGCCCCGAAAGGCGGCACCTTCCGCCCGTTCCGCCTCCTCCGG
ACCGACGGCCACAACTTCCTCCGACGATGGCCGACGGATTGGAGAGAGATGAACCAGCAAGTCGTCGCCAGCGCC
GTGTACATCTTCTTCACCAATCTTCTTCCCGGCATCACTTTTGCCAGCGACCTGTTTGAGCTGACGGGTCGGTCG
TGGGGGCCCATTGAGGTTGTTTTCAGTACGGGGCTGTGCGGTGTCGTCTTTGCCTTGTGAGTTAGGTTTTTTTTT
TGGGGGGGGGGGGGGGGTTTACTTAAAGAGGGGGGAAATGGGCTGGCTGTAACAACGATGTGAATCTGACTGTGA
GGGTTGGGGAATGGGGTCGGGATGAGGCAGATTCTCTGCTCAGCCGCTCACTATCCTCGGCGTGACGGGCCCCTT
TTCCGTCTTGGCTGAGAACATCTACCAGTTATGCGAGACACATTTCCATGTACGACGTTGGTCCTTCATCCAATC
CAAAGCCGTACCACATTCAACTAACCTGACCAAAAGATCGACTTCCTCCCCGTCATGGCTTGGACCCTCATCCAC
GCCGGCTGGATGCACCTCGTCCTCGCCATCTTCAACGCCCACGATTGGACGATGCGCTACGTCACCCACTTCAGC
GCCGACATCTTCTCCCTCCTCAACAGCGTCATCTACTTCCACAAGGCCGCTCTGGAGCTGCGGCGGACCCACGCC
GCCGTCTCGCTCGCCGCTTTTCTTTATGCCGTCATCGGCGCCGTCGGCACCTGTATCGTCGCCGTCTTTCTATCG
ACGGCCAATTCCTGGCGTCCGCTGTTGCATCGTTATCTGCGTTTGGGGCTGGCTGAGTATGCGGCTTCCATCTCC
ATCGTCCTTTGGATCGGCATCCCGCATATCGGCGAGCTGAACTCGCTCGATCATCAGAGGCTGCAGGTTCAGTCC
GAGCTTAGGCCTTCGGCGCCGGACCGTGCAGTCTTTCTCGTCCGTTTCTGGACTCTGCCCGTTGCTTGGGTCTTT
CTCGCCATCATTCCCGCTGCTATCGTCACCGTCCTCTTCTTCTTCGACCATGAGATTAGCAGCATCATCTGTACT
GCCTCCCGCTATCGTGTACGGAAACCCGGTGGCTTCGCCTGGGATGTCGCTCTGCTCGGCCTCACCACCCTCCTG
TGTGGCATCCTCGGCCTCCCGCCAGCCAACGGGTTACTGCCCCAGGCACCGCTGCATTCCGAGTCGTTACTACAT
CACGAAAAGACCACATCTCGCCATGATGATGGTGACAGCCAACCGCGGACATACGAGCAGCGGTACTCAGCCCTC
ATTCAATCCGCCCTCATCCTCGCCTTCATCTCGCCCCCCCTCCAACGTCTCCTCGGCCTGACGCAAACCTCGGTC
CTGGCCGGTCTCTTCATGTTCATGGGCTACCAATCCCTCGCCGTCAACCCCATCCTCTACCGCGTCGCCCACCTC
CTGACACCGCCCTCGGAGCTGCCTCCTCTTCCCCAAGCCGTCTCCTGGCTCGCCGTCCACGGCTTCACATTGACG
CAGATCGCCCTCACCGGCGCCGTCTTCGCCATGACGCTCACCGTCGCCGCCCCGGCCTTTCCCCTCGTCATCATC
GCCCTCGTGCCCGTCCGGCTCACGCTCATGGGCCGCATCTGGTCCCGCGAGACGTTGCGCTTCGTCGACGGCTGG
GCCTGTCGCCAGGGGAAGCCCGAGGACGGCGAGAGCGGGCCCGAGGTCCAGGCCGAGGCTCGGCCCGACGAGGAA
AAGGGTCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail