Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2694
Gene name
Locationscaffold_218:17633..19091
Strand+
Gene length (bp)1458
Transcript length (bp)1458
Coding sequence length (bp)1455
Protein length (aa) 485

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.658 0.3495 0.163 0.2284 0.1908 0.0761 0.2714 0.2028 0.2382 0.0777

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2056
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5686
Ophiocordyceps australis map64 (Brazil) OphauB2|1066
Ophiocordyceps camponoti-floridani Ophcf2|03488
Ophiocordyceps camponoti-rufipedis Ophun1|1451
Ophiocordyceps kimflemingae Ophio5|2694 (this protein)
Ophiocordyceps subramaniannii Hirsu2|237

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2694
MAESKAVWISPLPLPLPPLALNPSLSLSLSLPSSPPSPPPPPPPVRHPIVPLCCAATNASTPPPNAVTPPSSQQQ
PSRVPQSVSPPAESDIASCICPVLARLQGACLSNRKSLPSIPPRLGFCSRLPVHTSQSYSYSWLPRYHASPSPPV
LPTWPRYWQGAVCAQSALKLLFSLSLPALPYASRPAPPLSFSSLPFLSVSSLTLSLSPSFFISPHLVLAFSTLIM
PSRLGDSTLSRSNLPRFELPALDLGFGRITDGTNIPPPPASPVQKVPTPPQTPPTEKEDPLDHKQLDDADQSPDC
KDDKEPEGQDELLHSANGATRHLATPPNGNTAAPKRSDDDASLSPVGSGRESSLRRLFSRNVLSYPDAEGRSMSV
GATSMAASRPESRGTTIVADDRRRKRGSAWFRRLRGGDSRRSTIYFDETAQVTVVPIKAPDLSPKPCEEAHQIPA
SPPMPVGPPPPMIPELVHLEKADGILGNDLFKNIK
Coding >Ophio5|2694
ATGGCTGAAAGTAAAGCCGTGTGGATTTCTCCTCTTCCTCTTCCTCTTCCTCCTCTCGCCCTCAACCCTTCTCTC
TCTCTCTCTCTCTCTCTCCCCTCCTCTCCTCCTTCTCCTCCTCCTCCTCCCCCTCCTGTTCGCCATCCCATCGTT
CCCCTCTGCTGCGCCGCTACAAACGCTAGCACCCCTCCGCCAAACGCTGTCACCCCGCCGTCATCTCAGCAGCAA
CCCTCTCGCGTGCCACAAAGCGTCTCGCCCCCAGCAGAGTCAGACATCGCTAGCTGCATCTGCCCTGTACTTGCT
CGCCTCCAAGGGGCCTGTCTGTCGAACCGCAAATCCCTCCCATCCATACCTCCGAGGCTAGGGTTCTGCTCGAGG
CTGCCTGTACATACCTCCCAGAGCTACAGCTACAGCTGGTTGCCACGCTACCACGCCTCTCCATCACCTCCGGTA
CTACCTACTTGGCCTCGGTACTGGCAAGGCGCCGTCTGTGCTCAATCTGCTCTCAAGCTTCTCTTCTCTCTCTCT
CTCCCTGCTTTGCCCTACGCTTCAAGGCCCGCCCCGCCTCTCTCCTTCTCTTCTCTTCCCTTTCTCTCTGTCTCG
TCTCTCACCCTCTCTCTTTCACCATCTTTCTTCATCTCTCCGCATCTCGTTCTCGCCTTCTCTACGCTCATCATG
CCTTCTCGTCTCGGCGACTCAACGCTCTCGAGGTCTAACCTCCCCCGATTCGAGCTACCAGCTCTCGACCTCGGT
TTCGGCCGCATCACCGACGGCACCAACATCCCGCCCCCGCCCGCCTCCCCCGTCCAGAAGGTGCCGACACCGCCT
CAGACGCCACCGACCGAGAAGGAGGATCCTCTCGACCACAAACAACTGGACGACGCCGACCAGTCCCCTGACTGC
AAAGATGACAAGGAGCCCGAGGGTCAGGACGAGCTCCTTCATTCCGCCAATGGAGCGACTCGCCACCTTGCCACC
CCCCCAAATGGTAATACAGCTGCGCCCAAGCGCTCCGACGACGATGCTTCCTTGAGCCCCGTCGGCTCTGGCCGC
GAGAGCAGCCTCCGCCGGTTGTTTAGTAGGAATGTGCTGAGTTACCCTGATGCAGAGGGCCGATCCATGTCCGTG
GGAGCCACTTCCATGGCCGCTTCCCGCCCCGAGAGCCGCGGCACCACCATCGTCGCCGACGACCGGAGGAGGAAG
CGCGGCAGCGCCTGGTTCCGACGCCTGAGGGGAGGCGACTCTCGGCGCTCCACCATCTACTTCGACGAGACGGCG
CAAGTGACCGTCGTTCCCATCAAGGCTCCCGACCTGTCGCCGAAACCGTGCGAGGAAGCCCATCAGATTCCCGCC
TCTCCCCCGATGCCCGTCGGCCCTCCGCCCCCCATGATCCCGGAGCTCGTCCATCTGGAGAAAGCAGACGGCATC
TTGGGCAACGACTTGTTCAAGAATATTAAA
Transcript >Ophio5|2694
ATGGCTGAAAGTAAAGCCGTGTGGATTTCTCCTCTTCCTCTTCCTCTTCCTCCTCTCGCCCTCAACCCTTCTCTC
TCTCTCTCTCTCTCTCTCCCCTCCTCTCCTCCTTCTCCTCCTCCTCCTCCCCCTCCTGTTCGCCATCCCATCGTT
CCCCTCTGCTGCGCCGCTACAAACGCTAGCACCCCTCCGCCAAACGCTGTCACCCCGCCGTCATCTCAGCAGCAA
CCCTCTCGCGTGCCACAAAGCGTCTCGCCCCCAGCAGAGTCAGACATCGCTAGCTGCATCTGCCCTGTACTTGCT
CGCCTCCAAGGGGCCTGTCTGTCGAACCGCAAATCCCTCCCATCCATACCTCCGAGGCTAGGGTTCTGCTCGAGG
CTGCCTGTACATACCTCCCAGAGCTACAGCTACAGCTGGTTGCCACGCTACCACGCCTCTCCATCACCTCCGGTA
CTACCTACTTGGCCTCGGTACTGGCAAGGCGCCGTCTGTGCTCAATCTGCTCTCAAGCTTCTCTTCTCTCTCTCT
CTCCCTGCTTTGCCCTACGCTTCAAGGCCCGCCCCGCCTCTCTCCTTCTCTTCTCTTCCCTTTCTCTCTGTCTCG
TCTCTCACCCTCTCTCTTTCACCATCTTTCTTCATCTCTCCGCATCTCGTTCTCGCCTTCTCTACGCTCATCATG
CCTTCTCGTCTCGGCGACTCAACGCTCTCGAGGTCTAACCTCCCCCGATTCGAGCTACCAGCTCTCGACCTCGGT
TTCGGCCGCATCACCGACGGCACCAACATCCCGCCCCCGCCCGCCTCCCCCGTCCAGAAGGTGCCGACACCGCCT
CAGACGCCACCGACCGAGAAGGAGGATCCTCTCGACCACAAACAACTGGACGACGCCGACCAGTCCCCTGACTGC
AAAGATGACAAGGAGCCCGAGGGTCAGGACGAGCTCCTTCATTCCGCCAATGGAGCGACTCGCCACCTTGCCACC
CCCCCAAATGGTAATACAGCTGCGCCCAAGCGCTCCGACGACGATGCTTCCTTGAGCCCCGTCGGCTCTGGCCGC
GAGAGCAGCCTCCGCCGGTTGTTTAGTAGGAATGTGCTGAGTTACCCTGATGCAGAGGGCCGATCCATGTCCGTG
GGAGCCACTTCCATGGCCGCTTCCCGCCCCGAGAGCCGCGGCACCACCATCGTCGCCGACGACCGGAGGAGGAAG
CGCGGCAGCGCCTGGTTCCGACGCCTGAGGGGAGGCGACTCTCGGCGCTCCACCATCTACTTCGACGAGACGGCG
CAAGTGACCGTCGTTCCCATCAAGGCTCCCGACCTGTCGCCGAAACCGTGCGAGGAAGCCCATCAGATTCCCGCC
TCTCCCCCGATGCCCGTCGGCCCTCCGCCCCCCATGATCCCGGAGCTCGTCCATCTGGAGAAAGCAGACGGCATC
TTGGGCAACGACTTGTTCAAGAATATTAAATGA
Gene >Ophio5|2694
ATGGCTGAAAGTAAAGCCGTGTGGATTTCTCCTCTTCCTCTTCCTCTTCCTCCTCTCGCCCTCAACCCTTCTCTC
TCTCTCTCTCTCTCTCTCCCCTCCTCTCCTCCTTCTCCTCCTCCTCCTCCCCCTCCTGTTCGCCATCCCATCGTT
CCCCTCTGCTGCGCCGCTACAAACGCTAGCACCCCTCCGCCAAACGCTGTCACCCCGCCGTCATCTCAGCAGCAA
CCCTCTCGCGTGCCACAAAGCGTCTCGCCCCCAGCAGAGTCAGACATCGCTAGCTGCATCTGCCCTGTACTTGCT
CGCCTCCAAGGGGCCTGTCTGTCGAACCGCAAATCCCTCCCATCCATACCTCCGAGGCTAGGGTTCTGCTCGAGG
CTGCCTGTACATACCTCCCAGAGCTACAGCTACAGCTGGTTGCCACGCTACCACGCCTCTCCATCACCTCCGGTA
CTACCTACTTGGCCTCGGTACTGGCAAGGCGCCGTCTGTGCTCAATCTGCTCTCAAGCTTCTCTTCTCTCTCTCT
CTCCCTGCTTTGCCCTACGCTTCAAGGCCCGCCCCGCCTCTCTCCTTCTCTTCTCTTCCCTTTCTCTCTGTCTCG
TCTCTCACCCTCTCTCTTTCACCATCTTTCTTCATCTCTCCGCATCTCGTTCTCGCCTTCTCTACGCTCATCATG
CCTTCTCGTCTCGGCGACTCAACGCTCTCGAGGTCTAACCTCCCCCGATTCGAGCTACCAGCTCTCGACCTCGGT
TTCGGCCGCATCACCGACGGCACCAACATCCCGCCCCCGCCCGCCTCCCCCGTCCAGAAGGTGCCGACACCGCCT
CAGACGCCACCGACCGAGAAGGAGGATCCTCTCGACCACAAACAACTGGACGACGCCGACCAGTCCCCTGACTGC
AAAGATGACAAGGAGCCCGAGGGTCAGGACGAGCTCCTTCATTCCGCCAATGGAGCGACTCGCCACCTTGCCACC
CCCCCAAATGGTAATACAGCTGCGCCCAAGCGCTCCGACGACGATGCTTCCTTGAGCCCCGTCGGCTCTGGCCGC
GAGAGCAGCCTCCGCCGGTTGTTTAGTAGGAATGTGCTGAGTTACCCTGATGCAGAGGGCCGATCCATGTCCGTG
GGAGCCACTTCCATGGCCGCTTCCCGCCCCGAGAGCCGCGGCACCACCATCGTCGCCGACGACCGGAGGAGGAAG
CGCGGCAGCGCCTGGTTCCGACGCCTGAGGGGAGGCGACTCTCGGCGCTCCACCATCTACTTCGACGAGACGGCG
CAAGTGACCGTCGTTCCCATCAAGGCTCCCGACCTGTCGCCGAAACCGTGCGAGGAAGCCCATCAGATTCCCGCC
TCTCCCCCGATGCCCGTCGGCCCTCCGCCCCCCATGATCCCGGAGCTCGTCCATCTGGAGAAAGCAGACGGCATC
TTGGGCAACGACTTGTTCAAGAATATTAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail