Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2679
Gene name
Locationscaffold_217:11943..13253
Strand-
Gene length (bp)1310
Transcript length (bp)1254
Coding sequence length (bp)1251
Protein length (aa) 417

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 2.0E-25 82 310

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.571 0.478 0.1594 0.0687 0.1874 0.1498 0.1053 0.0531 0.1718 0.0387

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4242
Ophiocordyceps australis map64 (Brazil) OphauB2|729
Ophiocordyceps camponoti-floridani Ophcf2|03017
Ophiocordyceps camponoti-rufipedis Ophun1|3921
Ophiocordyceps kimflemingae Ophio5|2679 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2679
MPCHMMAQVKMAEERSADESAAGTLPGLGQARLFQLTKPPSIEALQSVCSRKTRPEDYPLAESIQDGIPIYRLAP
YDTTNTEQRAALQDELYRVLLDGPGVFVTKALFADHDVVDRVSRVFDAIIAQEAQAKTRKNGDHFAGEGTNDRIW
NALEKHGVADPASFLEYYSNRYLGLIANAWLGPGYRITAQVNNVRPGAKAQVCHRDYHLGFMSAQQCAQLPRTIH
VASQFLTLQGAVAHMDMPAASGPTRLLPYSQTLAAGYLAYRRPEFADYFQRHHVALPLEKGDGLFFNPALFHAAG
ENQAAADRMANLLQISSAFGKPMEAVDTLPLVDSCWHRLLTLFKQRGGASEEVGALVAAMAEGYPFPTNLDRNAP
TGDKMAPESEQDVLWDCLRAGLVKEAAMERLESHRRRAARHQ
Coding >Ophio5|2679
ATGCCGTGCCATATGATGGCTCAAGTGAAAATGGCAGAGGAGAGAAGCGCAGACGAGTCCGCAGCCGGCACCCTT
CCGGGCCTTGGGCAAGCTCGTCTCTTTCAGTTGACGAAGCCGCCTTCGATAGAGGCTCTCCAGTCTGTATGCTCA
CGGAAGACGAGGCCGGAGGATTACCCGCTCGCCGAGTCCATCCAAGACGGCATTCCGATTTACAGACTCGCACCA
TACGACACGACCAATACCGAGCAGCGGGCCGCTCTTCAAGATGAGCTGTACCGAGTCCTGCTCGACGGCCCCGGC
GTCTTCGTCACCAAGGCCTTGTTTGCGGACCACGACGTCGTCGACCGAGTCAGCCGCGTCTTTGACGCCATCATC
GCGCAAGAGGCGCAGGCCAAGACGCGAAAGAATGGCGATCACTTCGCTGGCGAGGGGACAAATGATCGGATCTGG
AACGCCTTGGAGAAACACGGTGTCGCGGATCCGGCTTCGTTCTTGGAATATTATTCCAATCGTTACCTTGGGCTC
ATTGCCAACGCCTGGCTCGGTCCGGGATACCGCATCACGGCACAGGTCAATAACGTCAGGCCAGGGGCTAAAGCA
CAGGTCTGCCATCGCGATTATCACCTCGGCTTCATGTCGGCCCAACAGTGCGCTCAGCTCCCTCGCACCATCCAC
GTCGCCAGTCAGTTCCTCACGCTGCAAGGCGCAGTGGCGCACATGGACATGCCGGCAGCCAGCGGGCCGACGCGC
CTCCTACCATACAGCCAAACGCTTGCGGCCGGCTATCTCGCATACCGACGGCCCGAGTTCGCCGACTACTTCCAG
CGGCATCACGTCGCCCTGCCGCTGGAAAAGGGCGACGGACTGTTCTTCAACCCGGCGCTGTTTCACGCCGCGGGC
GAGAACCAGGCTGCGGCCGATCGGATGGCGAATCTGCTACAGATAAGCAGTGCCTTTGGAAAGCCCATGGAGGCG
GTTGATACTTTGCCGTTGGTCGATAGCTGCTGGCATCGATTGCTGACGCTGTTTAAGCAGCGGGGGGGGGCGAGC
GAGGAGGTCGGGGCTTTGGTTGCTGCCATGGCCGAAGGCTATCCCTTTCCTACCAACTTGGATCGGAATGCGCCG
ACCGGTGACAAGATGGCGCCCGAGTCGGAGCAGGATGTGCTTTGGGACTGTTTGAGGGCCGGGCTGGTCAAGGAG
GCTGCTATGGAGAGGTTGGAGAGTCATCGACGACGGGCTGCAAGGCATCAG
Transcript >Ophio5|2679
ATGCCGTGCCATATGATGGCTCAAGTGAAAATGGCAGAGGAGAGAAGCGCAGACGAGTCCGCAGCCGGCACCCTT
CCGGGCCTTGGGCAAGCTCGTCTCTTTCAGTTGACGAAGCCGCCTTCGATAGAGGCTCTCCAGTCTGTATGCTCA
CGGAAGACGAGGCCGGAGGATTACCCGCTCGCCGAGTCCATCCAAGACGGCATTCCGATTTACAGACTCGCACCA
TACGACACGACCAATACCGAGCAGCGGGCCGCTCTTCAAGATGAGCTGTACCGAGTCCTGCTCGACGGCCCCGGC
GTCTTCGTCACCAAGGCCTTGTTTGCGGACCACGACGTCGTCGACCGAGTCAGCCGCGTCTTTGACGCCATCATC
GCGCAAGAGGCGCAGGCCAAGACGCGAAAGAATGGCGATCACTTCGCTGGCGAGGGGACAAATGATCGGATCTGG
AACGCCTTGGAGAAACACGGTGTCGCGGATCCGGCTTCGTTCTTGGAATATTATTCCAATCGTTACCTTGGGCTC
ATTGCCAACGCCTGGCTCGGTCCGGGATACCGCATCACGGCACAGGTCAATAACGTCAGGCCAGGGGCTAAAGCA
CAGGTCTGCCATCGCGATTATCACCTCGGCTTCATGTCGGCCCAACAGTGCGCTCAGCTCCCTCGCACCATCCAC
GTCGCCAGTCAGTTCCTCACGCTGCAAGGCGCAGTGGCGCACATGGACATGCCGGCAGCCAGCGGGCCGACGCGC
CTCCTACCATACAGCCAAACGCTTGCGGCCGGCTATCTCGCATACCGACGGCCCGAGTTCGCCGACTACTTCCAG
CGGCATCACGTCGCCCTGCCGCTGGAAAAGGGCGACGGACTGTTCTTCAACCCGGCGCTGTTTCACGCCGCGGGC
GAGAACCAGGCTGCGGCCGATCGGATGGCGAATCTGCTACAGATAAGCAGTGCCTTTGGAAAGCCCATGGAGGCG
GTTGATACTTTGCCGTTGGTCGATAGCTGCTGGCATCGATTGCTGACGCTGTTTAAGCAGCGGGGGGGGGCGAGC
GAGGAGGTCGGGGCTTTGGTTGCTGCCATGGCCGAAGGCTATCCCTTTCCTACCAACTTGGATCGGAATGCGCCG
ACCGGTGACAAGATGGCGCCCGAGTCGGAGCAGGATGTGCTTTGGGACTGTTTGAGGGCCGGGCTGGTCAAGGAG
GCTGCTATGGAGAGGTTGGAGAGTCATCGACGACGGGCTGCAAGGCATCAGTGA
Gene >Ophio5|2679
ATGCCGTGCCGTATTTATTGCCCGTCTACCCCGCCGCTTTCGTTGTTAACTCGGAGTTGATGACAGATATGATGG
CTCAAGTGAAAATGGCAGAGGAGAGAAGCGCAGACGAGTCCGCAGCCGGCACCCTTCCGGGCCTTGGGCAAGCTC
GTCTCTTTCAGTTGACGAAGCCGCCTTCGATAGAGGCTCTCCAGTCTGTATGCTCACGGAAGACGAGGCCGGAGG
ATTACCCGCTCGCCGAGTCCATCCAAGACGGCATTCCGATTTACAGACTCGCACCATACGACACGACCAATACCG
AGCAGCGGGCCGCTCTTCAAGATGAGCTGTACCGAGTCCTGCTCGACGGCCCCGGCGTCTTCGTCACCAAGGCCT
TGTTTGCGGACCACGACGTCGTCGACCGAGTCAGCCGCGTCTTTGACGCCATCATCGCGCAAGAGGCGCAGGCCA
AGACGCGAAAGAATGGCGATCACTTCGCTGGCGAGGGGACAAATGATCGGATCTGGAACGCCTTGGAGAAACACG
GTGTCGCGGATCCGGCTTCGTTCTTGGAATATTATTCCAATCGTTACCTTGGGCTCATTGCCAACGCCTGGCTCG
GTCCGGGATACCGCATCACGGCACAGGTCAATAACGTCAGGCCAGGGGCTAAAGCACAGGTCTGCCATCGCGATT
ATCACCTCGGCTTCATGTCGGCCCAACAGTGCGCTCAGCTCCCTCGCACCATCCACGTCGCCAGTCAGTTCCTCA
CGCTGCAAGGCGCAGTGGCGCACATGGACATGCCGGCAGCCAGCGGGCCGACGCGCCTCCTACCATACAGCCAAA
CGCTTGCGGCCGGCTATCTCGCATACCGACGGCCCGAGTTCGCCGACTACTTCCAGCGGCATCACGTCGCCCTGC
CGCTGGAAAAGGGCGACGGACTGTTCTTCAACCCGGCGCTGTTTCACGCCGCGGGCGAGAACCAGGCTGCGGCCG
ATCGGATGGCGAATCTGCTACAGATAAGCAGTGCCTTTGGAAAGCCCATGGAGGCGGTTGATACTTTGCCGTTGG
TCGATAGCTGCTGGCATCGATTGCTGACGCTGTTTAAGCAGCGGGGGGGGGCGAGCGAGGAGGTCGGGGCTTTGG
TTGCTGCCATGGCCGAAGGCTATCCCTTTCCTACCAACTTGGATCGGAATGCGCCGACCGGTGACAAGATGGCGC
CCGAGTCGGAGCAGGATGTGCTTTGGGACTGTTTGAGGGCCGGGCTGGTCAAGGAGGCTGCTATGGAGAGGTTGG
AGAGTCATCGACGACGGGCTGCAAGGCATCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail