Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2669
Gene name
Locationscaffold_216:17679..18063
Strand+
Gene length (bp)384
Transcript length (bp)384
Coding sequence length (bp)381
Protein length (aa) 127

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.5E-07 27 69
PF01476 LysM LysM domain 1.2E-08 80 126

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39046|MUR2_ENTHA Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=EHR_05900 PE=1 SV=1 27 126 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 46.27 15.48 77.05
CcL In ants, during behavior modification 0.91 0.00 2.38
CcD In ants, recently dead 2.10 0.00 5.11

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.061678 no
SC16a CcD 0.002236 yes
CcL CcD 0.385229 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2669
MGILHSLLLAGAFFSTAFAEPDCVEHYTVKPYDSCWKISIEKSVALKNLIAWNQHRGNCALYPGDVLCVAKYKVQ
CNRTHMVISNDWCWKIAKDNDIDLNKLVALNPNLVQSIDECNIHPGQQVCVG
Coding >Ophio5|2669
ATGGGCATTCTCCACAGCCTGCTCCTTGCTGGAGCTTTTTTCTCTACCGCTTTTGCCGAGCCTGACTGCGTCGAA
CACTATACAGTCAAGCCATACGATTCGTGCTGGAAAATCAGCATTGAAAAATCGGTCGCCCTCAAGAACCTCATT
GCCTGGAACCAGCACCGTGGCAACTGCGCTCTGTACCCGGGAGATGTGCTTTGCGTCGCCAAATATAAGGTCCAG
TGCAATCGCACTCACATGGTGATAAGCAACGATTGGTGCTGGAAGATAGCGAAAGACAACGACATCGATCTTAAC
AAACTAGTCGCGCTCAACCCGAATCTCGTGCAAAGCATCGACGAGTGCAATATCCACCCTGGACAGCAGGTTTGC
GTCGGC
Transcript >Ophio5|2669
ATGGGCATTCTCCACAGCCTGCTCCTTGCTGGAGCTTTTTTCTCTACCGCTTTTGCCGAGCCTGACTGCGTCGAA
CACTATACAGTCAAGCCATACGATTCGTGCTGGAAAATCAGCATTGAAAAATCGGTCGCCCTCAAGAACCTCATT
GCCTGGAACCAGCACCGTGGCAACTGCGCTCTGTACCCGGGAGATGTGCTTTGCGTCGCCAAATATAAGGTCCAG
TGCAATCGCACTCACATGGTGATAAGCAACGATTGGTGCTGGAAGATAGCGAAAGACAACGACATCGATCTTAAC
AAACTAGTCGCGCTCAACCCGAATCTCGTGCAAAGCATCGACGAGTGCAATATCCACCCTGGACAGCAGGTTTGC
GTCGGCTAG
Gene >Ophio5|2669
ATGGGCATTCTCCACAGCCTGCTCCTTGCTGGAGCTTTTTTCTCTACCGCTTTTGCCGAGCCTGACTGCGTCGAA
CACTATACAGTCAAGCCATACGATTCGTGCTGGAAAATCAGCATTGAAAAATCGGTCGCCCTCAAGAACCTCATT
GCCTGGAACCAGCACCGTGGCAACTGCGCTCTGTACCCGGGAGATGTGCTTTGCGTCGCCAAATATAAGGTCCAG
TGCAATCGCACTCACATGGTGATAAGCAACGATTGGTGCTGGAAGATAGCGAAAGACAACGACATCGATCTTAAC
AAACTAGTCGCGCTCAACCCGAATCTCGTGCAAAGCATCGACGAGTGCAATATCCACCCTGGACAGCAGGTTTGC
GTCGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail