Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2669
Gene name
Locationscaffold_216:17679..18063
Strand+
Gene length (bp)384
Transcript length (bp)384
Coding sequence length (bp)381
Protein length (aa) 127

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.5E-07 27 69
PF01476 LysM LysM domain 1.2E-08 80 126

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39046|MUR2_ENTHA Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=EHR_05900 PE=1 SV=1 27 126 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2669
MGILHSLLLAGAFFSTAFAEPDCVEHYTVKPYDSCWKISIEKSVALKNLIAWNQHRGNCALYPGDVLCVAKYKVQ
CNRTHMVISNDWCWKIAKDNDIDLNKLVALNPNLVQSIDECNIHPGQQVCVG
Coding >Ophio5|2669
ATGGGCATTCTCCACAGCCTGCTCCTTGCTGGAGCTTTTTTCTCTACCGCTTTTGCCGAGCCTGACTGCGTCGAA
CACTATACAGTCAAGCCATACGATTCGTGCTGGAAAATCAGCATTGAAAAATCGGTCGCCCTCAAGAACCTCATT
GCCTGGAACCAGCACCGTGGCAACTGCGCTCTGTACCCGGGAGATGTGCTTTGCGTCGCCAAATATAAGGTCCAG
TGCAATCGCACTCACATGGTGATAAGCAACGATTGGTGCTGGAAGATAGCGAAAGACAACGACATCGATCTTAAC
AAACTAGTCGCGCTCAACCCGAATCTCGTGCAAAGCATCGACGAGTGCAATATCCACCCTGGACAGCAGGTTTGC
GTCGGC
Transcript >Ophio5|2669
ATGGGCATTCTCCACAGCCTGCTCCTTGCTGGAGCTTTTTTCTCTACCGCTTTTGCCGAGCCTGACTGCGTCGAA
CACTATACAGTCAAGCCATACGATTCGTGCTGGAAAATCAGCATTGAAAAATCGGTCGCCCTCAAGAACCTCATT
GCCTGGAACCAGCACCGTGGCAACTGCGCTCTGTACCCGGGAGATGTGCTTTGCGTCGCCAAATATAAGGTCCAG
TGCAATCGCACTCACATGGTGATAAGCAACGATTGGTGCTGGAAGATAGCGAAAGACAACGACATCGATCTTAAC
AAACTAGTCGCGCTCAACCCGAATCTCGTGCAAAGCATCGACGAGTGCAATATCCACCCTGGACAGCAGGTTTGC
GTCGGCTAG
Gene >Ophio5|2669
ATGGGCATTCTCCACAGCCTGCTCCTTGCTGGAGCTTTTTTCTCTACCGCTTTTGCCGAGCCTGACTGCGTCGAA
CACTATACAGTCAAGCCATACGATTCGTGCTGGAAAATCAGCATTGAAAAATCGGTCGCCCTCAAGAACCTCATT
GCCTGGAACCAGCACCGTGGCAACTGCGCTCTGTACCCGGGAGATGTGCTTTGCGTCGCCAAATATAAGGTCCAG
TGCAATCGCACTCACATGGTGATAAGCAACGATTGGTGCTGGAAGATAGCGAAAGACAACGACATCGATCTTAAC
AAACTAGTCGCGCTCAACCCGAATCTCGTGCAAAGCATCGACGAGTGCAATATCCACCCTGGACAGCAGGTTTGC
GTCGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail