Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2661
Gene name
Locationscaffold_216:5098..5863
Strand-
Gene length (bp)765
Transcript length (bp)633
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00578 AhpC-TSA AhpC/TSA family 1.1E-37 6 139
PF08534 Redoxin Redoxin 6.1E-14 7 150
PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin 2.1E-11 160 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NL98|PRDX_ASCSU Peroxiredoxin OS=Ascaris suum PE=2 SV=1 1 193 5.0E-87
sp|P0CB50|PRDX1_CHICK Peroxiredoxin-1 OS=Gallus gallus GN=PRDX1 PE=1 SV=1 1 193 3.0E-82
sp|P35704|PRDX2_RAT Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1 SV=3 3 193 6.0E-81
sp|Q9BGI2|PRDX4_BOVIN Peroxiredoxin-4 OS=Bos taurus GN=PRDX4 PE=2 SV=1 1 193 1.0E-80
sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 OS=Homo sapiens GN=PRDX4 PE=1 SV=1 1 193 1.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NL98|PRDX_ASCSU Peroxiredoxin OS=Ascaris suum PE=2 SV=1 1 193 5.0E-87
sp|P0CB50|PRDX1_CHICK Peroxiredoxin-1 OS=Gallus gallus GN=PRDX1 PE=1 SV=1 1 193 3.0E-82
sp|P35704|PRDX2_RAT Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1 SV=3 3 193 6.0E-81
sp|Q9BGI2|PRDX4_BOVIN Peroxiredoxin-4 OS=Bos taurus GN=PRDX4 PE=2 SV=1 1 193 1.0E-80
sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 OS=Homo sapiens GN=PRDX4 PE=1 SV=1 1 193 1.0E-80
sp|Q9BGI3|PRDX2_BOVIN Peroxiredoxin-2 OS=Bos taurus GN=PRDX2 PE=2 SV=1 1 193 2.0E-80
sp|Q8K3U7|PRDX2_CRIGR Peroxiredoxin-2 OS=Cricetulus griseus GN=PRDX2 PE=2 SV=3 3 193 3.0E-80
sp|Q17172|TDX2_BRUMA Thioredoxin peroxidase 2 OS=Brugia malayi GN=tsa-2 PE=2 SV=2 2 193 3.0E-80
sp|Q61171|PRDX2_MOUSE Peroxiredoxin-2 OS=Mus musculus GN=Prdx2 PE=1 SV=3 3 193 4.0E-80
sp|Q9V3P0|PRDX1_DROME Peroxiredoxin 1 OS=Drosophila melanogaster GN=Jafrac1 PE=1 SV=1 6 196 7.0E-80
sp|Q6DV14|PRDX1_GECJA Peroxiredoxin-1 OS=Gecko japonicus GN=PRDX1 PE=2 SV=1 1 193 9.0E-80
sp|O08807|PRDX4_MOUSE Peroxiredoxin-4 OS=Mus musculus GN=Prdx4 PE=1 SV=1 1 193 1.0E-79
sp|O74887|TSA1_SCHPO Peroxiredoxin tpx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpx1 PE=1 SV=1 3 193 1.0E-79
sp|Q9Z0V5|PRDX4_RAT Peroxiredoxin-4 OS=Rattus norvegicus GN=Prdx4 PE=2 SV=1 1 193 2.0E-79
sp|Q2PFZ3|PRDX2_MACFA Peroxiredoxin-2 OS=Macaca fascicularis GN=PRDX2 PE=2 SV=3 3 193 3.0E-79
sp|P32119|PRDX2_HUMAN Peroxiredoxin-2 OS=Homo sapiens GN=PRDX2 PE=1 SV=5 3 193 3.0E-79
sp|Q6B4U9|PRDX1_MYOLU Peroxiredoxin-1 OS=Myotis lucifugus GN=PRDX1 PE=1 SV=1 1 193 5.0E-79
sp|Q90384|TDX_CYNPY Peroxiredoxin OS=Cynops pyrrhogaster PE=2 SV=1 4 193 7.0E-79
sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 OS=Homo sapiens GN=PRDX1 PE=1 SV=1 1 193 9.0E-79
sp|Q26695|TDX_TRYBR Thioredoxin peroxidase OS=Trypanosoma brucei rhodesiense PE=2 SV=1 4 193 1.0E-78
sp|P20108|PRDX3_MOUSE Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus GN=Prdx3 PE=1 SV=1 3 197 5.0E-78
sp|P35705|PRDX3_BOVIN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Bos taurus GN=PRDX3 PE=1 SV=2 5 193 6.0E-78
sp|Q63716|PRDX1_RAT Peroxiredoxin-1 OS=Rattus norvegicus GN=Prdx1 PE=1 SV=1 1 193 2.0E-77
sp|Q9Z0V6|PRDX3_RAT Thioredoxin-dependent peroxide reductase, mitochondrial OS=Rattus norvegicus GN=Prdx3 PE=1 SV=2 3 197 4.0E-77
sp|P35700|PRDX1_MOUSE Peroxiredoxin-1 OS=Mus musculus GN=Prdx1 PE=1 SV=1 1 193 4.0E-77
sp|Q5REY3|PRDX3_PONAB Thioredoxin-dependent peroxide reductase, mitochondrial OS=Pongo abelii GN=PRDX3 PE=2 SV=1 5 193 9.0E-77
sp|Q9JKY1|PRDX1_CRIGR Peroxiredoxin-1 OS=Cricetulus griseus GN=PRDX1 PE=1 SV=1 1 193 1.0E-76
sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens GN=PRDX3 PE=1 SV=3 5 193 2.0E-76
sp|Q5E947|PRDX1_BOVIN Peroxiredoxin-1 OS=Bos taurus GN=PRDX1 PE=2 SV=1 1 193 2.0E-76
sp|Q8T6C4|TDX_ECHGR Thioredoxin peroxidase OS=Echinococcus granulosus GN=TPX PE=2 SV=1 3 196 3.0E-75
sp|Q9Y7F0|TSA1_CANAL Peroxiredoxin TSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSA1 PE=2 SV=1 6 193 6.0E-74
sp|P91883|TDX_FASHE Thioredoxin peroxidase OS=Fasciola hepatica PE=2 SV=1 9 193 2.0E-72
sp|Q555L5|PRDX4_DICDI Peroxiredoxin-4 OS=Dictyostelium discoideum GN=prdx4 PE=1 SV=2 6 197 6.0E-71
sp|P34760|TSA1_YEAST Peroxiredoxin TSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA1 PE=1 SV=3 4 197 3.0E-70
sp|P48822|TDX1_BRUMA Thioredoxin peroxidase 1 OS=Brugia malayi GN=TSA1 PE=2 SV=1 7 200 4.0E-70
sp|Q04120|TSA2_YEAST Peroxiredoxin TSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA2 PE=1 SV=3 4 193 4.0E-70
sp|Q91191|TDX_ONCMY Peroxiredoxin OS=Oncorhynchus mykiss PE=2 SV=1 4 193 1.0E-69
sp|Q96468|BAS1_HORVU 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Hordeum vulgare GN=BAS1 PE=2 SV=1 6 195 3.0E-69
sp|P80602|BAS1_WHEAT 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Triticum aestivum GN=TSA PE=1 SV=2 6 195 7.0E-69
sp|Q21824|TDX1_CAEEL Probable peroxiredoxin prdx-3 OS=Caenorhabditis elegans GN=prdx-3 PE=3 SV=1 11 193 4.0E-68
sp|Q5RC63|PRDX2_PONAB Peroxiredoxin-2 OS=Pongo abelii GN=PRDX2 PE=2 SV=3 3 170 1.0E-67
sp|Q6ER94|BAS1_ORYSJ 2-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza sativa subsp. japonica GN=BAS1 PE=1 SV=1 10 195 4.0E-67
sp|Q96291|BAS1A_ARATH 2-Cys peroxiredoxin BAS1, chloroplastic OS=Arabidopsis thaliana GN=BAS1 PE=1 SV=2 6 195 5.0E-67
sp|Q1XDL4|YCF42_PYRYE Putative peroxiredoxin ycf42 OS=Pyropia yezoensis GN=ycf42 PE=3 SV=1 10 195 6.0E-67
sp|O24364|BAS1_SPIOL 2-Cys peroxiredoxin BAS1, chloroplastic OS=Spinacia oleracea GN=BAS1 PE=2 SV=1 6 195 3.0E-66
sp|Q9C5R8|BAS1B_ARATH 2-Cys peroxiredoxin BAS1-like, chloroplastic OS=Arabidopsis thaliana GN=At5g06290 PE=2 SV=3 6 195 4.0E-66
sp|P51272|YCF42_PORPU Putative peroxiredoxin ycf42 OS=Porphyra purpurea GN=ycf42 PE=3 SV=1 6 195 7.0E-66
sp|Q55624|Y755_SYNY3 Putative peroxiredoxin sll0755 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0755 PE=3 SV=1 6 193 7.0E-62
sp|P19476|CR29_ENTHI Putative peroxiredoxin OS=Entamoeba histolytica PE=1 SV=2 4 195 5.0E-57
sp|P23161|R20K_CLOPA Putative peroxiredoxin in rubredoxin operon OS=Clostridium pasteurianum PE=3 SV=1 6 178 3.0E-54
sp|P56876|TSAA_HELPJ Probable peroxiredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tsaA PE=1 SV=1 6 193 3.0E-49
sp|O34564|YKUU_BACSU Thioredoxin-like protein YkuU OS=Bacillus subtilis (strain 168) GN=ykuU PE=3 SV=1 1 182 8.0E-49
sp|P21762|TSAA_HELPY Probable peroxiredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tsaA PE=1 SV=3 6 193 1.0E-48
sp|Q89AS1|TSAA_BUCBP Probable peroxiredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_171 PE=3 SV=1 6 192 4.0E-47
sp|P57279|TSAA_BUCAI Probable peroxiredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU182 PE=3 SV=1 6 193 6.0E-47
sp|P49537|YCF42_ODOSI Putative peroxiredoxin ycf42 OS=Odontella sinensis GN=ycf42 PE=3 SV=1 6 193 8.0E-47
sp|P52552|PRDX2_PIG Peroxiredoxin-2 (Fragment) OS=Sus scrofa GN=PRDX2 PE=2 SV=1 38 165 1.0E-45
sp|Q8K9W0|TSAA_BUCAP Probable peroxiredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_176 PE=3 SV=1 6 192 3.0E-43
sp|Q8CMQ2|AHPC_STAES Alkyl hydroperoxide reductase subunit C OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ahpC PE=3 SV=1 13 183 6.0E-40
sp|Q9L3Q5|PRXU_EUBAC Selenocysteine-containing peroxiredoxin PrxU OS=Eubacterium acidaminophilum GN=prxU PE=1 SV=2 4 186 7.0E-40
sp|Q5HRY1|AHPC_STAEQ Alkyl hydroperoxide reductase subunit C OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ahpC PE=3 SV=1 13 183 9.0E-40
sp|Q4L376|AHPC_STAHJ Alkyl hydroperoxide reductase subunit C OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ahpC PE=3 SV=1 22 183 3.0E-39
sp|Q02UU0|AHPC_PSEAB Alkyl hydroperoxide reductase subunit C OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ahpC PE=1 SV=1 13 182 8.0E-39
sp|P80239|AHPC_BACSU Alkyl hydroperoxide reductase subunit C OS=Bacillus subtilis (strain 168) GN=ahpC PE=1 SV=2 13 182 1.0E-38
sp|Q8SS85|TDX_ENCCU Putative thioredoxin peroxidase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_1190 PE=1 SV=1 8 180 2.0E-38
sp|P0AE11|AHPC_SHIFL Alkyl hydroperoxide reductase subunit C OS=Shigella flexneri GN=ahpC PE=3 SV=2 13 182 7.0E-38
sp|P0AE08|AHPC_ECOLI Alkyl hydroperoxide reductase subunit C OS=Escherichia coli (strain K12) GN=ahpC PE=1 SV=2 13 182 7.0E-38
sp|P0AE09|AHPC_ECOL6 Alkyl hydroperoxide reductase subunit C OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ahpC PE=3 SV=2 13 182 7.0E-38
sp|P0AE10|AHPC_ECO57 Alkyl hydroperoxide reductase subunit C OS=Escherichia coli O157:H7 GN=ahpC PE=3 SV=2 13 182 7.0E-38
sp|Q8R844|TDXH2_CALS4 Peroxiredoxin 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE2186 PE=3 SV=1 9 191 1.0E-37
sp|P0A0B6|AHPC_STAAW Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain MW2) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q6GC91|AHPC_STAAS Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain MSSA476) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q6GJR7|AHPC_STAAR Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain MRSA252) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|P99074|AHPC_STAAN Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain N315) GN=ahpC PE=1 SV=1 13 183 3.0E-37
sp|P0A0B5|AHPC_STAAM Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q5HIR5|AHPC_STAAC Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain COL) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q2YVK2|AHPC_STAAB Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|P0A0B7|AHPC_STAA8 Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpC PE=1 SV=1 13 183 3.0E-37
sp|Q2FJN4|AHPC_STAA3 Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain USA300) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|P0A251|AHPC_SALTY Alkyl hydroperoxide reductase subunit C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ahpC PE=1 SV=2 13 182 4.0E-37
sp|P0A252|AHPC_SALTI Alkyl hydroperoxide reductase subunit C OS=Salmonella typhi GN=ahpC PE=3 SV=2 13 182 4.0E-37
sp|P26830|YNDH_BACYN Putative peroxiredoxin in ndh 5'region (Fragment) OS=Bacillus sp. (strain YN-1) PE=3 SV=1 22 183 7.0E-37
sp|Q49UT8|AHPC_STAS1 Alkyl hydroperoxide reductase subunit C OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ahpC PE=3 SV=1 22 183 1.0E-36
sp|Q9HJL3|TDXH2_THEAC Peroxiredoxin 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0954 PE=3 SV=1 10 201 4.0E-34
sp|Q979N7|TDXH_THEVO Peroxiredoxin OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1123 PE=3 SV=1 10 186 3.0E-33
sp|O67024|TDXH_AQUAE Peroxiredoxin OS=Aquifex aeolicus (strain VF5) GN=aq_858 PE=3 SV=1 8 181 3.0E-32
sp|Q6L140|TDXH2_PICTO Peroxiredoxin 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0727 PE=3 SV=1 8 186 2.0E-31
sp|Q9WZR4|TDXH_THEMA Peroxiredoxin OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0807 PE=3 SV=1 12 175 2.0E-30
sp|A0R1V9|AHPC_MYCS2 Alkyl hydroperoxide reductase subunit C OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_4891 PE=1 SV=1 1 184 4.0E-30
sp|A2BJD9|TDXH_HYPBU Peroxiredoxin OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=Hbut_0228 PE=3 SV=1 25 175 7.0E-30
sp|A5IIX7|TDXH_THEP1 Peroxiredoxin OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0121 PE=3 SV=1 12 175 9.0E-30
sp|A3DKL1|TDXH_STAMF Peroxiredoxin OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_0058 PE=3 SV=1 19 175 1.0E-27
sp|A8A9P0|TDXH_IGNH4 Peroxiredoxin OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0459 PE=3 SV=1 29 175 1.0E-27
sp|P9WQB7|AHPC_MYCTU Alkyl hydroperoxide reductase subunit C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ahpC PE=1 SV=1 23 184 3.0E-27
sp|P9WQB6|AHPC_MYCTO Alkyl hydroperoxide reductase subunit C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ahpC PE=3 SV=1 23 184 3.0E-27
sp|Q8RCY5|TDXH1_CALS4 Peroxiredoxin 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0270 PE=3 SV=2 13 175 3.0E-27
sp|Q8PYP6|TDXH_METMA Peroxiredoxin OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0814 PE=3 SV=1 10 204 6.0E-27
sp|Q74NC6|TDXH_NANEQ Peroxiredoxin OS=Nanoarchaeum equitans (strain Kin4-M) GN=NEQ191 PE=3 SV=1 25 176 3.0E-26
sp|Q58146|TDXH_METJA Peroxiredoxin OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0736 PE=3 SV=2 32 175 3.0E-26
sp|Q96XS5|TDXH2_SULTO Peroxiredoxin 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_24420 PE=3 SV=1 25 187 1.0E-25
sp|P95895|TDXH_SULSO Peroxiredoxin OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2121 PE=3 SV=1 1 187 3.0E-25
sp|O29969|TDXH_ARCFU Peroxiredoxin OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0270 PE=3 SV=2 31 175 4.0E-25
sp|Q57109|TDXH_METTM Peroxiredoxin OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c06100 PE=3 SV=2 29 175 1.0E-24
sp|Q8U218|TDXH_PYRFU Peroxiredoxin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1033 PE=3 SV=1 32 206 3.0E-24
sp|Q55060|TDXH1_SULME Peroxiredoxin 1 OS=Sulfolobus metallicus PE=3 SV=1 32 186 7.0E-24
sp|O33665|TDXH2_SULME Peroxiredoxin 2 OS=Sulfolobus metallicus PE=3 SV=1 32 186 7.0E-24
sp|O26262|TDXH_METTH Peroxiredoxin OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_159 PE=3 SV=2 29 175 1.0E-23
sp|Q5JF30|TDXH_THEKO Peroxiredoxin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0537 PE=3 SV=1 32 175 3.0E-23
sp|Q9UZV4|TDXH_PYRAB Peroxiredoxin OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB10420 PE=3 SV=1 32 175 6.0E-23
sp|Q9HKX0|TDXH1_THEAC Peroxiredoxin 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0473 PE=3 SV=2 32 188 6.0E-23
sp|Q6LY19|TDXH_METMP Peroxiredoxin OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1174 PE=3 SV=1 33 175 7.0E-23
sp|A6UPH7|TDXH_METVS Peroxiredoxin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0492 PE=3 SV=1 33 175 9.0E-23
sp|A4FWZ9|TDXH_METM5 Peroxiredoxin OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0413 PE=3 SV=1 33 175 3.0E-22
sp|Q6L240|TDXH1_PICTO Peroxiredoxin 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0377 PE=3 SV=1 29 175 4.0E-22
sp|Q73RS4|TDXH_TREDE Peroxiredoxin OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0011 PE=3 SV=2 12 175 7.0E-22
sp|O58966|TDXH_PYRHO Peroxiredoxin OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ahpC PE=1 SV=1 32 210 3.0E-21
sp|Q8KBN8|TDXH_CHLTE Peroxiredoxin OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT1747 PE=3 SV=1 30 175 5.0E-21
sp|Q9Y9L0|TDXH_AERPE Peroxiredoxin OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_2278 PE=1 SV=1 32 175 2.0E-20
sp|Q974S8|TDXH1_SULTO Peroxiredoxin 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_05840 PE=3 SV=1 32 186 7.0E-19
sp|Q54SE2|PRDXL_DICDI Peroxiredoxin-like protein DDB_G0282517, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0282517 PE=3 SV=1 10 182 1.0E-16
sp|P34227|PRX1_YEAST Mitochondrial peroxiredoxin PRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRX1 PE=1 SV=1 6 182 1.0E-16
sp|Q5ZJF4|PRDX6_CHICK Peroxiredoxin-6 OS=Gallus gallus GN=PRDX6 PE=2 SV=3 10 178 6.0E-15
sp|P0C5C9|REHYA_ORYSJ 1-Cys peroxiredoxin A OS=Oryza sativa subsp. japonica GN=Os07g0638300 PE=2 SV=1 25 182 3.0E-14
sp|Q9TSX9|PRDX6_PIG Peroxiredoxin-6 OS=Sus scrofa GN=PRDX6 PE=2 SV=3 10 178 4.0E-14
sp|P0C5C8|REHYA_ORYSI 1-Cys peroxiredoxin A OS=Oryza sativa subsp. indica GN=OsI_27030 PE=2 SV=1 25 182 4.0E-14
sp|Q6QPJ6|PRXQ_POPJC Peroxiredoxin Q, chloroplastic OS=Populus jackii GN=PRXQ PE=1 SV=1 24 161 4.0E-14
sp|Q5S1S6|PRXQ_WHEAT Peroxiredoxin Q, chloroplastic OS=Triticum aestivum GN=PRX1 PE=1 SV=1 24 159 6.0E-14
sp|Q9MB35|PERQ_SEDLI Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum lineare GN=PRXQ PE=1 SV=1 24 162 1.0E-13
sp|O35244|PRDX6_RAT Peroxiredoxin-6 OS=Rattus norvegicus GN=Prdx6 PE=1 SV=3 10 182 1.0E-13
sp|O17433|1CPX_DIRIM 1-Cys peroxiredoxin OS=Dirofilaria immitis PE=2 SV=1 32 182 2.0E-13
sp|Q6W8Q2|REHY_WHEAT 1-Cys peroxiredoxin PER1 OS=Triticum aestivum GN=PER1 PE=2 SV=1 25 178 2.0E-13
sp|O77834|PRDX6_BOVIN Peroxiredoxin-6 OS=Bos taurus GN=PRDX6 PE=1 SV=3 10 178 2.0E-13
sp|O08709|PRDX6_MOUSE Peroxiredoxin-6 OS=Mus musculus GN=Prdx6 PE=1 SV=3 10 182 2.0E-13
sp|P52572|REHY_HORVU 1-Cys peroxiredoxin PER1 OS=Hordeum vulgare GN=PER1 PE=2 SV=1 25 178 2.0E-13
sp|Q6E2Z6|REHY_MEDTR 1-Cys peroxiredoxin OS=Medicago truncatula PE=2 SV=1 35 182 2.0E-13
sp|Q6UBI3|PERQ_SUASA Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=PRXQ PE=1 SV=1 24 161 3.0E-13
sp|P65689|Y2262_MYCBO Putative peroxiredoxin Mb2262c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2262c PE=3 SV=1 5 138 3.0E-13
sp|P9WIE3|Y2238_MYCTU Putative peroxiredoxin Rv2238c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2238c PE=1 SV=1 5 138 3.0E-13
sp|P9WIE2|Y2238_MYCTO Putative peroxiredoxin MT2298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2298 PE=3 SV=1 5 138 3.0E-13
sp|Q9LU86|PRXQ_ARATH Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana GN=PRXQ PE=1 SV=1 10 160 4.0E-13
sp|Q2PFL9|PRDX6_MACFA Peroxiredoxin-6 OS=Macaca fascicularis GN=PRDX6 PE=2 SV=3 10 178 2.0E-12
sp|P52570|TSA_ONCVO Putative peroxiredoxin OS=Onchocerca volvulus GN=TSA PE=2 SV=1 11 182 3.0E-12
sp|Q75SY5|PRXQ_GENTR Peroxiredoxin Q, chloroplastic OS=Gentiana triflora GN=AFP1 PE=1 SV=1 24 160 4.0E-12
sp|P52571|REHY_BROSE Probable 1-Cys peroxiredoxin (Fragment) OS=Bromus secalinus PE=2 SV=1 25 178 4.0E-12
sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens GN=PRDX6 PE=1 SV=3 10 178 4.0E-12
sp|Q5R7E0|PRDX6_PONAB Peroxiredoxin-6 OS=Pongo abelii GN=PRDX6 PE=2 SV=3 10 178 8.0E-12
sp|P52574|REHY_TORRU Probable 1-Cys peroxiredoxin OS=Tortula ruralis PE=2 SV=1 35 182 1.0E-11
sp|P0C5D1|REHYB_ORYSJ 1-Cys peroxiredoxin B OS=Oryza sativa subsp. japonica GN=Os07g0638400 PE=1 SV=1 25 182 1.0E-11
sp|A2SZW8|REHY_MAIZE 1-Cys peroxiredoxin PER1 OS=Zea mays GN=PER1 PE=2 SV=1 25 178 3.0E-11
sp|P0C5D5|PRXQ_ORYSJ Peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0196300 PE=1 SV=1 10 161 3.0E-11
sp|P0C5D4|PRXQ_ORYSI Putative peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_22010 PE=1 SV=1 10 161 3.0E-11
sp|Q83CY8|BCP_COXBU Putative peroxiredoxin bcp OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bcp PE=1 SV=1 3 140 5.0E-11
sp|P0C5D0|REHYB_ORYSI 1-Cys peroxiredoxin B OS=Oryza sativa subsp. indica GN=OsI_026085 PE=3 SV=1 25 182 6.0E-11
sp|P72314|AHPC_RHORU Alkyl hydroperoxide reductase subunit C (Fragment) OS=Rhodospirillum rubrum GN=ahpC PE=3 SV=1 13 70 6.0E-10
sp|Q796Y8|BCP_BACSU Putative peroxiredoxin YgaF OS=Bacillus subtilis (strain 168) GN=ygaF PE=3 SV=1 26 169 2.0E-09
sp|O04005|REHY_ARATH 1-Cys peroxiredoxin PER1 OS=Arabidopsis thaliana GN=PER1 PE=2 SV=1 19 175 2.0E-08
sp|P0CV91|PRDX4_CROAT Peroxiredoxin-4 (Fragments) OS=Crotalus atrox PE=1 SV=1 127 166 4.0E-08
sp|P80864|TPX_BACSU Probable thiol peroxidase OS=Bacillus subtilis (strain 168) GN=tpx PE=1 SV=3 10 137 6.0E-08
sp|P55979|BCP_HELPY Putative peroxiredoxin bcp OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bcp PE=3 SV=1 1 137 1.0E-07
sp|Q9ZMU4|BCP_HELPJ Putative peroxiredoxin bcp OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bcp PE=3 SV=1 1 137 2.0E-07
sp|P44411|BCP_HAEIN Putative peroxiredoxin bcp OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcp PE=3 SV=1 1 116 4.0E-07
sp|Q92BC5|TPX_LISIN Probable thiol peroxidase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tpx PE=3 SV=1 10 135 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051920 peroxiredoxin activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0016209 antioxidant activity Yes
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 124.32 66.60 182.04
CcL In ants, during behavior modification 426.20 206.69 645.71
CcD In ants, recently dead 367.39 193.10 541.67

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.588995 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2661
MSSASVQKPAPDFTSQAVVAGQFKKISLSDLRGQWVILLFYPLDFTFVCPTEIIEFNDALAKFREINTTVLAIST
DSHYSHLAWTERPRSQGGLGKDLQLPLVADKSLRISKSYGVLLEDEGIALRGLFIIDPKGIVRVININDLPVGRS
VTETIRLVEAFQFVEEHGEACPAGWNKGAKTIKADPKGSLEYFLATHGENGQAKGNGHAH
Coding >Ophio5|2661
ATGTCTTCCGCTTCGGTGCAGAAGCCCGCTCCGGACTTTACCTCCCAGGCTGTCGTGGCTGGGCAGTTCAAGAAG
ATTTCCCTCTCTGACCTCCGCGGGCAGTGGGTCATCCTGCTTTTTTACCCCCTCGACTTCACCTTTGTCTGCCCT
ACCGAAATCATCGAGTTCAACGACGCACTCGCCAAATTCCGTGAGATCAATACCACGGTGCTGGCCATCTCCACC
GACTCGCACTACTCCCACCTCGCCTGGACGGAGCGTCCGCGCAGCCAAGGCGGCCTCGGCAAGGACCTGCAGCTT
CCCCTCGTCGCGGACAAGTCGCTCCGCATCTCGAAGAGCTATGGCGTGCTGCTCGAGGACGAGGGCATCGCTCTC
CGCGGTCTCTTTATCATCGATCCCAAGGGAATCGTAAGGGTCATCAACATCAATGATCTGCCCGTCGGACGAAGC
GTGACCGAGACCATCCGTCTGGTCGAGGCATTCCAGTTCGTCGAGGAACACGGAGAGGCCTGCCCGGCTGGCTGG
AACAAGGGCGCCAAGACGATTAAAGCCGATCCTAAGGGGAGCCTCGAGTACTTCTTGGCCACCCACGGCGAGAAT
GGCCAGGCCAAGGGGAATGGGCATGCCCAT
Transcript >Ophio5|2661
ATGTCTTCCGCTTCGGTGCAGAAGCCCGCTCCGGACTTTACCTCCCAGGCTGTCGTGGCTGGGCAGTTCAAGAAG
ATTTCCCTCTCTGACCTCCGCGGGCAGTGGGTCATCCTGCTTTTTTACCCCCTCGACTTCACCTTTGTCTGCCCT
ACCGAAATCATCGAGTTCAACGACGCACTCGCCAAATTCCGTGAGATCAATACCACGGTGCTGGCCATCTCCACC
GACTCGCACTACTCCCACCTCGCCTGGACGGAGCGTCCGCGCAGCCAAGGCGGCCTCGGCAAGGACCTGCAGCTT
CCCCTCGTCGCGGACAAGTCGCTCCGCATCTCGAAGAGCTATGGCGTGCTGCTCGAGGACGAGGGCATCGCTCTC
CGCGGTCTCTTTATCATCGATCCCAAGGGAATCGTAAGGGTCATCAACATCAATGATCTGCCCGTCGGACGAAGC
GTGACCGAGACCATCCGTCTGGTCGAGGCATTCCAGTTCGTCGAGGAACACGGAGAGGCCTGCCCGGCTGGCTGG
AACAAGGGCGCCAAGACGATTAAAGCCGATCCTAAGGGGAGCCTCGAGTACTTCTTGGCCACCCACGGCGAGAAT
GGCCAGGCCAAGGGGAATGGGCATGCCCATTGA
Gene >Ophio5|2661
ATGTCTTCCGCTTCGGTGCAGAAGCCCGCTCCGGACTTTACCTCCCAGGCTGTCGTGGCTGGGCAGTTCAAGAAG
ATTTCCCTCTCTGACCTCCGCGGGCAGTGGTAAGTTGGCTGGCTTCGATACTCGTCCCTACATCTCACACTCTCA
GGGTCATCCTGCTTTTTTACCCCCTCGACTTCACCTTTGTCTGCCCTACCGAAATCATCGAGTTCAACGACGCAC
TCGCCAAATTCCGTGAGATCAATACCACGGTGCTGGCCATCTCCACCGACTCGCACTACTCCCACCTCGCCTGGA
CGGAGCGTCCGCGCAGCCAAGGCGGCCTCGGCAAGGACCTGCAGCTTCCCCTCGTCGCGGACAAGTCGCTCCGCA
TCTCGAAGAGCTATGGCGTGCTGCTCGAGGACGAGGGCATCGCTCTCCGCGGTCTCTTTATCATCGATCCCAAGG
GAATCGTAAGGGTCATCAACATCAATGATCTGCCCGTCGGACGAAGCGTGACCGAGACCATCCGTCTGGTCGAGG
CATTCCAGTTCGTCGAGGAACACGGAGAGGCCTGCCCGGCTGGCTGGAACAAGGGCGCCAAGACGATTAAAGCCG
ATCCTAAGGGGAGCCTCGAGTACTTCTTGGCCACCCACGGCGAGAATGGCCAGGCCAAGGGGAATGGTGAGTCAA
ACAAGCGATTAAGGATGGAGTAGGCGAGACAAAAGGCTCGCAGACGAAGCCACACTCGATGCTTACATGTCGATA
GGGCATGCCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail