Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2661
Gene name
Locationscaffold_216:5098..5863
Strand-
Gene length (bp)765
Transcript length (bp)633
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00578 AhpC-TSA AhpC/TSA family 1.1E-37 6 139
PF08534 Redoxin Redoxin 6.1E-14 7 150
PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin 2.1E-11 160 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NL98|PRDX_ASCSU Peroxiredoxin OS=Ascaris suum PE=2 SV=1 1 193 5.0E-87
sp|P0CB50|PRDX1_CHICK Peroxiredoxin-1 OS=Gallus gallus GN=PRDX1 PE=1 SV=1 1 193 3.0E-82
sp|P35704|PRDX2_RAT Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1 SV=3 3 193 6.0E-81
sp|Q9BGI2|PRDX4_BOVIN Peroxiredoxin-4 OS=Bos taurus GN=PRDX4 PE=2 SV=1 1 193 1.0E-80
sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 OS=Homo sapiens GN=PRDX4 PE=1 SV=1 1 193 1.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NL98|PRDX_ASCSU Peroxiredoxin OS=Ascaris suum PE=2 SV=1 1 193 5.0E-87
sp|P0CB50|PRDX1_CHICK Peroxiredoxin-1 OS=Gallus gallus GN=PRDX1 PE=1 SV=1 1 193 3.0E-82
sp|P35704|PRDX2_RAT Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1 SV=3 3 193 6.0E-81
sp|Q9BGI2|PRDX4_BOVIN Peroxiredoxin-4 OS=Bos taurus GN=PRDX4 PE=2 SV=1 1 193 1.0E-80
sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 OS=Homo sapiens GN=PRDX4 PE=1 SV=1 1 193 1.0E-80
sp|Q9BGI3|PRDX2_BOVIN Peroxiredoxin-2 OS=Bos taurus GN=PRDX2 PE=2 SV=1 1 193 2.0E-80
sp|Q8K3U7|PRDX2_CRIGR Peroxiredoxin-2 OS=Cricetulus griseus GN=PRDX2 PE=2 SV=3 3 193 3.0E-80
sp|Q17172|TDX2_BRUMA Thioredoxin peroxidase 2 OS=Brugia malayi GN=tsa-2 PE=2 SV=2 2 193 3.0E-80
sp|Q61171|PRDX2_MOUSE Peroxiredoxin-2 OS=Mus musculus GN=Prdx2 PE=1 SV=3 3 193 4.0E-80
sp|Q9V3P0|PRDX1_DROME Peroxiredoxin 1 OS=Drosophila melanogaster GN=Jafrac1 PE=1 SV=1 6 196 7.0E-80
sp|Q6DV14|PRDX1_GECJA Peroxiredoxin-1 OS=Gecko japonicus GN=PRDX1 PE=2 SV=1 1 193 9.0E-80
sp|O08807|PRDX4_MOUSE Peroxiredoxin-4 OS=Mus musculus GN=Prdx4 PE=1 SV=1 1 193 1.0E-79
sp|O74887|TSA1_SCHPO Peroxiredoxin tpx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpx1 PE=1 SV=1 3 193 1.0E-79
sp|Q9Z0V5|PRDX4_RAT Peroxiredoxin-4 OS=Rattus norvegicus GN=Prdx4 PE=2 SV=1 1 193 2.0E-79
sp|Q2PFZ3|PRDX2_MACFA Peroxiredoxin-2 OS=Macaca fascicularis GN=PRDX2 PE=2 SV=3 3 193 3.0E-79
sp|P32119|PRDX2_HUMAN Peroxiredoxin-2 OS=Homo sapiens GN=PRDX2 PE=1 SV=5 3 193 3.0E-79
sp|Q6B4U9|PRDX1_MYOLU Peroxiredoxin-1 OS=Myotis lucifugus GN=PRDX1 PE=1 SV=1 1 193 5.0E-79
sp|Q90384|TDX_CYNPY Peroxiredoxin OS=Cynops pyrrhogaster PE=2 SV=1 4 193 7.0E-79
sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 OS=Homo sapiens GN=PRDX1 PE=1 SV=1 1 193 9.0E-79
sp|Q26695|TDX_TRYBR Thioredoxin peroxidase OS=Trypanosoma brucei rhodesiense PE=2 SV=1 4 193 1.0E-78
sp|P20108|PRDX3_MOUSE Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus GN=Prdx3 PE=1 SV=1 3 197 5.0E-78
sp|P35705|PRDX3_BOVIN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Bos taurus GN=PRDX3 PE=1 SV=2 5 193 6.0E-78
sp|Q63716|PRDX1_RAT Peroxiredoxin-1 OS=Rattus norvegicus GN=Prdx1 PE=1 SV=1 1 193 2.0E-77
sp|Q9Z0V6|PRDX3_RAT Thioredoxin-dependent peroxide reductase, mitochondrial OS=Rattus norvegicus GN=Prdx3 PE=1 SV=2 3 197 4.0E-77
sp|P35700|PRDX1_MOUSE Peroxiredoxin-1 OS=Mus musculus GN=Prdx1 PE=1 SV=1 1 193 4.0E-77
sp|Q5REY3|PRDX3_PONAB Thioredoxin-dependent peroxide reductase, mitochondrial OS=Pongo abelii GN=PRDX3 PE=2 SV=1 5 193 9.0E-77
sp|Q9JKY1|PRDX1_CRIGR Peroxiredoxin-1 OS=Cricetulus griseus GN=PRDX1 PE=1 SV=1 1 193 1.0E-76
sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens GN=PRDX3 PE=1 SV=3 5 193 2.0E-76
sp|Q5E947|PRDX1_BOVIN Peroxiredoxin-1 OS=Bos taurus GN=PRDX1 PE=2 SV=1 1 193 2.0E-76
sp|Q8T6C4|TDX_ECHGR Thioredoxin peroxidase OS=Echinococcus granulosus GN=TPX PE=2 SV=1 3 196 3.0E-75
sp|Q9Y7F0|TSA1_CANAL Peroxiredoxin TSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSA1 PE=2 SV=1 6 193 6.0E-74
sp|P91883|TDX_FASHE Thioredoxin peroxidase OS=Fasciola hepatica PE=2 SV=1 9 193 2.0E-72
sp|Q555L5|PRDX4_DICDI Peroxiredoxin-4 OS=Dictyostelium discoideum GN=prdx4 PE=1 SV=2 6 197 6.0E-71
sp|P34760|TSA1_YEAST Peroxiredoxin TSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA1 PE=1 SV=3 4 197 3.0E-70
sp|P48822|TDX1_BRUMA Thioredoxin peroxidase 1 OS=Brugia malayi GN=TSA1 PE=2 SV=1 7 200 4.0E-70
sp|Q04120|TSA2_YEAST Peroxiredoxin TSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA2 PE=1 SV=3 4 193 4.0E-70
sp|Q91191|TDX_ONCMY Peroxiredoxin OS=Oncorhynchus mykiss PE=2 SV=1 4 193 1.0E-69
sp|Q96468|BAS1_HORVU 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Hordeum vulgare GN=BAS1 PE=2 SV=1 6 195 3.0E-69
sp|P80602|BAS1_WHEAT 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Triticum aestivum GN=TSA PE=1 SV=2 6 195 7.0E-69
sp|Q21824|TDX1_CAEEL Probable peroxiredoxin prdx-3 OS=Caenorhabditis elegans GN=prdx-3 PE=3 SV=1 11 193 4.0E-68
sp|Q5RC63|PRDX2_PONAB Peroxiredoxin-2 OS=Pongo abelii GN=PRDX2 PE=2 SV=3 3 170 1.0E-67
sp|Q6ER94|BAS1_ORYSJ 2-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza sativa subsp. japonica GN=BAS1 PE=1 SV=1 10 195 4.0E-67
sp|Q96291|BAS1A_ARATH 2-Cys peroxiredoxin BAS1, chloroplastic OS=Arabidopsis thaliana GN=BAS1 PE=1 SV=2 6 195 5.0E-67
sp|Q1XDL4|YCF42_PYRYE Putative peroxiredoxin ycf42 OS=Pyropia yezoensis GN=ycf42 PE=3 SV=1 10 195 6.0E-67
sp|O24364|BAS1_SPIOL 2-Cys peroxiredoxin BAS1, chloroplastic OS=Spinacia oleracea GN=BAS1 PE=2 SV=1 6 195 3.0E-66
sp|Q9C5R8|BAS1B_ARATH 2-Cys peroxiredoxin BAS1-like, chloroplastic OS=Arabidopsis thaliana GN=At5g06290 PE=2 SV=3 6 195 4.0E-66
sp|P51272|YCF42_PORPU Putative peroxiredoxin ycf42 OS=Porphyra purpurea GN=ycf42 PE=3 SV=1 6 195 7.0E-66
sp|Q55624|Y755_SYNY3 Putative peroxiredoxin sll0755 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0755 PE=3 SV=1 6 193 7.0E-62
sp|P19476|CR29_ENTHI Putative peroxiredoxin OS=Entamoeba histolytica PE=1 SV=2 4 195 5.0E-57
sp|P23161|R20K_CLOPA Putative peroxiredoxin in rubredoxin operon OS=Clostridium pasteurianum PE=3 SV=1 6 178 3.0E-54
sp|P56876|TSAA_HELPJ Probable peroxiredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tsaA PE=1 SV=1 6 193 3.0E-49
sp|O34564|YKUU_BACSU Thioredoxin-like protein YkuU OS=Bacillus subtilis (strain 168) GN=ykuU PE=3 SV=1 1 182 8.0E-49
sp|P21762|TSAA_HELPY Probable peroxiredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tsaA PE=1 SV=3 6 193 1.0E-48
sp|Q89AS1|TSAA_BUCBP Probable peroxiredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_171 PE=3 SV=1 6 192 4.0E-47
sp|P57279|TSAA_BUCAI Probable peroxiredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU182 PE=3 SV=1 6 193 6.0E-47
sp|P49537|YCF42_ODOSI Putative peroxiredoxin ycf42 OS=Odontella sinensis GN=ycf42 PE=3 SV=1 6 193 8.0E-47
sp|P52552|PRDX2_PIG Peroxiredoxin-2 (Fragment) OS=Sus scrofa GN=PRDX2 PE=2 SV=1 38 165 1.0E-45
sp|Q8K9W0|TSAA_BUCAP Probable peroxiredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_176 PE=3 SV=1 6 192 3.0E-43
sp|Q8CMQ2|AHPC_STAES Alkyl hydroperoxide reductase subunit C OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ahpC PE=3 SV=1 13 183 6.0E-40
sp|Q9L3Q5|PRXU_EUBAC Selenocysteine-containing peroxiredoxin PrxU OS=Eubacterium acidaminophilum GN=prxU PE=1 SV=2 4 186 7.0E-40
sp|Q5HRY1|AHPC_STAEQ Alkyl hydroperoxide reductase subunit C OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ahpC PE=3 SV=1 13 183 9.0E-40
sp|Q4L376|AHPC_STAHJ Alkyl hydroperoxide reductase subunit C OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ahpC PE=3 SV=1 22 183 3.0E-39
sp|Q02UU0|AHPC_PSEAB Alkyl hydroperoxide reductase subunit C OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ahpC PE=1 SV=1 13 182 8.0E-39
sp|P80239|AHPC_BACSU Alkyl hydroperoxide reductase subunit C OS=Bacillus subtilis (strain 168) GN=ahpC PE=1 SV=2 13 182 1.0E-38
sp|Q8SS85|TDX_ENCCU Putative thioredoxin peroxidase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_1190 PE=1 SV=1 8 180 2.0E-38
sp|P0AE11|AHPC_SHIFL Alkyl hydroperoxide reductase subunit C OS=Shigella flexneri GN=ahpC PE=3 SV=2 13 182 7.0E-38
sp|P0AE08|AHPC_ECOLI Alkyl hydroperoxide reductase subunit C OS=Escherichia coli (strain K12) GN=ahpC PE=1 SV=2 13 182 7.0E-38
sp|P0AE09|AHPC_ECOL6 Alkyl hydroperoxide reductase subunit C OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ahpC PE=3 SV=2 13 182 7.0E-38
sp|P0AE10|AHPC_ECO57 Alkyl hydroperoxide reductase subunit C OS=Escherichia coli O157:H7 GN=ahpC PE=3 SV=2 13 182 7.0E-38
sp|Q8R844|TDXH2_CALS4 Peroxiredoxin 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE2186 PE=3 SV=1 9 191 1.0E-37
sp|P0A0B6|AHPC_STAAW Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain MW2) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q6GC91|AHPC_STAAS Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain MSSA476) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q6GJR7|AHPC_STAAR Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain MRSA252) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|P99074|AHPC_STAAN Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain N315) GN=ahpC PE=1 SV=1 13 183 3.0E-37
sp|P0A0B5|AHPC_STAAM Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q5HIR5|AHPC_STAAC Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain COL) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|Q2YVK2|AHPC_STAAB Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|P0A0B7|AHPC_STAA8 Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpC PE=1 SV=1 13 183 3.0E-37
sp|Q2FJN4|AHPC_STAA3 Alkyl hydroperoxide reductase subunit C OS=Staphylococcus aureus (strain USA300) GN=ahpC PE=3 SV=1 13 183 3.0E-37
sp|P0A251|AHPC_SALTY Alkyl hydroperoxide reductase subunit C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ahpC PE=1 SV=2 13 182 4.0E-37
sp|P0A252|AHPC_SALTI Alkyl hydroperoxide reductase subunit C OS=Salmonella typhi GN=ahpC PE=3 SV=2 13 182 4.0E-37
sp|P26830|YNDH_BACYN Putative peroxiredoxin in ndh 5'region (Fragment) OS=Bacillus sp. (strain YN-1) PE=3 SV=1 22 183 7.0E-37
sp|Q49UT8|AHPC_STAS1 Alkyl hydroperoxide reductase subunit C OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ahpC PE=3 SV=1 22 183 1.0E-36
sp|Q9HJL3|TDXH2_THEAC Peroxiredoxin 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0954 PE=3 SV=1 10 201 4.0E-34
sp|Q979N7|TDXH_THEVO Peroxiredoxin OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1123 PE=3 SV=1 10 186 3.0E-33
sp|O67024|TDXH_AQUAE Peroxiredoxin OS=Aquifex aeolicus (strain VF5) GN=aq_858 PE=3 SV=1 8 181 3.0E-32
sp|Q6L140|TDXH2_PICTO Peroxiredoxin 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0727 PE=3 SV=1 8 186 2.0E-31
sp|Q9WZR4|TDXH_THEMA Peroxiredoxin OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0807 PE=3 SV=1 12 175 2.0E-30
sp|A0R1V9|AHPC_MYCS2 Alkyl hydroperoxide reductase subunit C OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_4891 PE=1 SV=1 1 184 4.0E-30
sp|A2BJD9|TDXH_HYPBU Peroxiredoxin OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=Hbut_0228 PE=3 SV=1 25 175 7.0E-30
sp|A5IIX7|TDXH_THEP1 Peroxiredoxin OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0121 PE=3 SV=1 12 175 9.0E-30
sp|A3DKL1|TDXH_STAMF Peroxiredoxin OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_0058 PE=3 SV=1 19 175 1.0E-27
sp|A8A9P0|TDXH_IGNH4 Peroxiredoxin OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0459 PE=3 SV=1 29 175 1.0E-27
sp|P9WQB7|AHPC_MYCTU Alkyl hydroperoxide reductase subunit C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ahpC PE=1 SV=1 23 184 3.0E-27
sp|P9WQB6|AHPC_MYCTO Alkyl hydroperoxide reductase subunit C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ahpC PE=3 SV=1 23 184 3.0E-27
sp|Q8RCY5|TDXH1_CALS4 Peroxiredoxin 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0270 PE=3 SV=2 13 175 3.0E-27
sp|Q8PYP6|TDXH_METMA Peroxiredoxin OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0814 PE=3 SV=1 10 204 6.0E-27
sp|Q74NC6|TDXH_NANEQ Peroxiredoxin OS=Nanoarchaeum equitans (strain Kin4-M) GN=NEQ191 PE=3 SV=1 25 176 3.0E-26
sp|Q58146|TDXH_METJA Peroxiredoxin OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0736 PE=3 SV=2 32 175 3.0E-26
sp|Q96XS5|TDXH2_SULTO Peroxiredoxin 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_24420 PE=3 SV=1 25 187 1.0E-25
sp|P95895|TDXH_SULSO Peroxiredoxin OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2121 PE=3 SV=1 1 187 3.0E-25
sp|O29969|TDXH_ARCFU Peroxiredoxin OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0270 PE=3 SV=2 31 175 4.0E-25
sp|Q57109|TDXH_METTM Peroxiredoxin OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c06100 PE=3 SV=2 29 175 1.0E-24
sp|Q8U218|TDXH_PYRFU Peroxiredoxin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1033 PE=3 SV=1 32 206 3.0E-24
sp|Q55060|TDXH1_SULME Peroxiredoxin 1 OS=Sulfolobus metallicus PE=3 SV=1 32 186 7.0E-24
sp|O33665|TDXH2_SULME Peroxiredoxin 2 OS=Sulfolobus metallicus PE=3 SV=1 32 186 7.0E-24
sp|O26262|TDXH_METTH Peroxiredoxin OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_159 PE=3 SV=2 29 175 1.0E-23
sp|Q5JF30|TDXH_THEKO Peroxiredoxin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0537 PE=3 SV=1 32 175 3.0E-23
sp|Q9UZV4|TDXH_PYRAB Peroxiredoxin OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB10420 PE=3 SV=1 32 175 6.0E-23
sp|Q9HKX0|TDXH1_THEAC Peroxiredoxin 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0473 PE=3 SV=2 32 188 6.0E-23
sp|Q6LY19|TDXH_METMP Peroxiredoxin OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1174 PE=3 SV=1 33 175 7.0E-23
sp|A6UPH7|TDXH_METVS Peroxiredoxin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0492 PE=3 SV=1 33 175 9.0E-23
sp|A4FWZ9|TDXH_METM5 Peroxiredoxin OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0413 PE=3 SV=1 33 175 3.0E-22
sp|Q6L240|TDXH1_PICTO Peroxiredoxin 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0377 PE=3 SV=1 29 175 4.0E-22
sp|Q73RS4|TDXH_TREDE Peroxiredoxin OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0011 PE=3 SV=2 12 175 7.0E-22
sp|O58966|TDXH_PYRHO Peroxiredoxin OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ahpC PE=1 SV=1 32 210 3.0E-21
sp|Q8KBN8|TDXH_CHLTE Peroxiredoxin OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT1747 PE=3 SV=1 30 175 5.0E-21
sp|Q9Y9L0|TDXH_AERPE Peroxiredoxin OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_2278 PE=1 SV=1 32 175 2.0E-20
sp|Q974S8|TDXH1_SULTO Peroxiredoxin 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_05840 PE=3 SV=1 32 186 7.0E-19
sp|Q54SE2|PRDXL_DICDI Peroxiredoxin-like protein DDB_G0282517, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0282517 PE=3 SV=1 10 182 1.0E-16
sp|P34227|PRX1_YEAST Mitochondrial peroxiredoxin PRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRX1 PE=1 SV=1 6 182 1.0E-16
sp|Q5ZJF4|PRDX6_CHICK Peroxiredoxin-6 OS=Gallus gallus GN=PRDX6 PE=2 SV=3 10 178 6.0E-15
sp|P0C5C9|REHYA_ORYSJ 1-Cys peroxiredoxin A OS=Oryza sativa subsp. japonica GN=Os07g0638300 PE=2 SV=1 25 182 3.0E-14
sp|Q9TSX9|PRDX6_PIG Peroxiredoxin-6 OS=Sus scrofa GN=PRDX6 PE=2 SV=3 10 178 4.0E-14
sp|P0C5C8|REHYA_ORYSI 1-Cys peroxiredoxin A OS=Oryza sativa subsp. indica GN=OsI_27030 PE=2 SV=1 25 182 4.0E-14
sp|Q6QPJ6|PRXQ_POPJC Peroxiredoxin Q, chloroplastic OS=Populus jackii GN=PRXQ PE=1 SV=1 24 161 4.0E-14
sp|Q5S1S6|PRXQ_WHEAT Peroxiredoxin Q, chloroplastic OS=Triticum aestivum GN=PRX1 PE=1 SV=1 24 159 6.0E-14
sp|Q9MB35|PERQ_SEDLI Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum lineare GN=PRXQ PE=1 SV=1 24 162 1.0E-13
sp|O35244|PRDX6_RAT Peroxiredoxin-6 OS=Rattus norvegicus GN=Prdx6 PE=1 SV=3 10 182 1.0E-13
sp|O17433|1CPX_DIRIM 1-Cys peroxiredoxin OS=Dirofilaria immitis PE=2 SV=1 32 182 2.0E-13
sp|Q6W8Q2|REHY_WHEAT 1-Cys peroxiredoxin PER1 OS=Triticum aestivum GN=PER1 PE=2 SV=1 25 178 2.0E-13
sp|O77834|PRDX6_BOVIN Peroxiredoxin-6 OS=Bos taurus GN=PRDX6 PE=1 SV=3 10 178 2.0E-13
sp|O08709|PRDX6_MOUSE Peroxiredoxin-6 OS=Mus musculus GN=Prdx6 PE=1 SV=3 10 182 2.0E-13
sp|P52572|REHY_HORVU 1-Cys peroxiredoxin PER1 OS=Hordeum vulgare GN=PER1 PE=2 SV=1 25 178 2.0E-13
sp|Q6E2Z6|REHY_MEDTR 1-Cys peroxiredoxin OS=Medicago truncatula PE=2 SV=1 35 182 2.0E-13
sp|Q6UBI3|PERQ_SUASA Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=PRXQ PE=1 SV=1 24 161 3.0E-13
sp|P65689|Y2262_MYCBO Putative peroxiredoxin Mb2262c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2262c PE=3 SV=1 5 138 3.0E-13
sp|P9WIE3|Y2238_MYCTU Putative peroxiredoxin Rv2238c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2238c PE=1 SV=1 5 138 3.0E-13
sp|P9WIE2|Y2238_MYCTO Putative peroxiredoxin MT2298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2298 PE=3 SV=1 5 138 3.0E-13
sp|Q9LU86|PRXQ_ARATH Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana GN=PRXQ PE=1 SV=1 10 160 4.0E-13
sp|Q2PFL9|PRDX6_MACFA Peroxiredoxin-6 OS=Macaca fascicularis GN=PRDX6 PE=2 SV=3 10 178 2.0E-12
sp|P52570|TSA_ONCVO Putative peroxiredoxin OS=Onchocerca volvulus GN=TSA PE=2 SV=1 11 182 3.0E-12
sp|Q75SY5|PRXQ_GENTR Peroxiredoxin Q, chloroplastic OS=Gentiana triflora GN=AFP1 PE=1 SV=1 24 160 4.0E-12
sp|P52571|REHY_BROSE Probable 1-Cys peroxiredoxin (Fragment) OS=Bromus secalinus PE=2 SV=1 25 178 4.0E-12
sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens GN=PRDX6 PE=1 SV=3 10 178 4.0E-12
sp|Q5R7E0|PRDX6_PONAB Peroxiredoxin-6 OS=Pongo abelii GN=PRDX6 PE=2 SV=3 10 178 8.0E-12
sp|P52574|REHY_TORRU Probable 1-Cys peroxiredoxin OS=Tortula ruralis PE=2 SV=1 35 182 1.0E-11
sp|P0C5D1|REHYB_ORYSJ 1-Cys peroxiredoxin B OS=Oryza sativa subsp. japonica GN=Os07g0638400 PE=1 SV=1 25 182 1.0E-11
sp|A2SZW8|REHY_MAIZE 1-Cys peroxiredoxin PER1 OS=Zea mays GN=PER1 PE=2 SV=1 25 178 3.0E-11
sp|P0C5D5|PRXQ_ORYSJ Peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0196300 PE=1 SV=1 10 161 3.0E-11
sp|P0C5D4|PRXQ_ORYSI Putative peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_22010 PE=1 SV=1 10 161 3.0E-11
sp|Q83CY8|BCP_COXBU Putative peroxiredoxin bcp OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bcp PE=1 SV=1 3 140 5.0E-11
sp|P0C5D0|REHYB_ORYSI 1-Cys peroxiredoxin B OS=Oryza sativa subsp. indica GN=OsI_026085 PE=3 SV=1 25 182 6.0E-11
sp|P72314|AHPC_RHORU Alkyl hydroperoxide reductase subunit C (Fragment) OS=Rhodospirillum rubrum GN=ahpC PE=3 SV=1 13 70 6.0E-10
sp|Q796Y8|BCP_BACSU Putative peroxiredoxin YgaF OS=Bacillus subtilis (strain 168) GN=ygaF PE=3 SV=1 26 169 2.0E-09
sp|O04005|REHY_ARATH 1-Cys peroxiredoxin PER1 OS=Arabidopsis thaliana GN=PER1 PE=2 SV=1 19 175 2.0E-08
sp|P0CV91|PRDX4_CROAT Peroxiredoxin-4 (Fragments) OS=Crotalus atrox PE=1 SV=1 127 166 4.0E-08
sp|P80864|TPX_BACSU Probable thiol peroxidase OS=Bacillus subtilis (strain 168) GN=tpx PE=1 SV=3 10 137 6.0E-08
sp|P55979|BCP_HELPY Putative peroxiredoxin bcp OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bcp PE=3 SV=1 1 137 1.0E-07
sp|Q9ZMU4|BCP_HELPJ Putative peroxiredoxin bcp OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bcp PE=3 SV=1 1 137 2.0E-07
sp|P44411|BCP_HAEIN Putative peroxiredoxin bcp OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcp PE=3 SV=1 1 116 4.0E-07
sp|Q92BC5|TPX_LISIN Probable thiol peroxidase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tpx PE=3 SV=1 10 135 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051920 peroxiredoxin activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0016209 antioxidant activity Yes
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2661
MSSASVQKPAPDFTSQAVVAGQFKKISLSDLRGQWVILLFYPLDFTFVCPTEIIEFNDALAKFREINTTVLAIST
DSHYSHLAWTERPRSQGGLGKDLQLPLVADKSLRISKSYGVLLEDEGIALRGLFIIDPKGIVRVININDLPVGRS
VTETIRLVEAFQFVEEHGEACPAGWNKGAKTIKADPKGSLEYFLATHGENGQAKGNGHAH
Coding >Ophio5|2661
ATGTCTTCCGCTTCGGTGCAGAAGCCCGCTCCGGACTTTACCTCCCAGGCTGTCGTGGCTGGGCAGTTCAAGAAG
ATTTCCCTCTCTGACCTCCGCGGGCAGTGGGTCATCCTGCTTTTTTACCCCCTCGACTTCACCTTTGTCTGCCCT
ACCGAAATCATCGAGTTCAACGACGCACTCGCCAAATTCCGTGAGATCAATACCACGGTGCTGGCCATCTCCACC
GACTCGCACTACTCCCACCTCGCCTGGACGGAGCGTCCGCGCAGCCAAGGCGGCCTCGGCAAGGACCTGCAGCTT
CCCCTCGTCGCGGACAAGTCGCTCCGCATCTCGAAGAGCTATGGCGTGCTGCTCGAGGACGAGGGCATCGCTCTC
CGCGGTCTCTTTATCATCGATCCCAAGGGAATCGTAAGGGTCATCAACATCAATGATCTGCCCGTCGGACGAAGC
GTGACCGAGACCATCCGTCTGGTCGAGGCATTCCAGTTCGTCGAGGAACACGGAGAGGCCTGCCCGGCTGGCTGG
AACAAGGGCGCCAAGACGATTAAAGCCGATCCTAAGGGGAGCCTCGAGTACTTCTTGGCCACCCACGGCGAGAAT
GGCCAGGCCAAGGGGAATGGGCATGCCCAT
Transcript >Ophio5|2661
ATGTCTTCCGCTTCGGTGCAGAAGCCCGCTCCGGACTTTACCTCCCAGGCTGTCGTGGCTGGGCAGTTCAAGAAG
ATTTCCCTCTCTGACCTCCGCGGGCAGTGGGTCATCCTGCTTTTTTACCCCCTCGACTTCACCTTTGTCTGCCCT
ACCGAAATCATCGAGTTCAACGACGCACTCGCCAAATTCCGTGAGATCAATACCACGGTGCTGGCCATCTCCACC
GACTCGCACTACTCCCACCTCGCCTGGACGGAGCGTCCGCGCAGCCAAGGCGGCCTCGGCAAGGACCTGCAGCTT
CCCCTCGTCGCGGACAAGTCGCTCCGCATCTCGAAGAGCTATGGCGTGCTGCTCGAGGACGAGGGCATCGCTCTC
CGCGGTCTCTTTATCATCGATCCCAAGGGAATCGTAAGGGTCATCAACATCAATGATCTGCCCGTCGGACGAAGC
GTGACCGAGACCATCCGTCTGGTCGAGGCATTCCAGTTCGTCGAGGAACACGGAGAGGCCTGCCCGGCTGGCTGG
AACAAGGGCGCCAAGACGATTAAAGCCGATCCTAAGGGGAGCCTCGAGTACTTCTTGGCCACCCACGGCGAGAAT
GGCCAGGCCAAGGGGAATGGGCATGCCCATTGA
Gene >Ophio5|2661
ATGTCTTCCGCTTCGGTGCAGAAGCCCGCTCCGGACTTTACCTCCCAGGCTGTCGTGGCTGGGCAGTTCAAGAAG
ATTTCCCTCTCTGACCTCCGCGGGCAGTGGTAAGTTGGCTGGCTTCGATACTCGTCCCTACATCTCACACTCTCA
GGGTCATCCTGCTTTTTTACCCCCTCGACTTCACCTTTGTCTGCCCTACCGAAATCATCGAGTTCAACGACGCAC
TCGCCAAATTCCGTGAGATCAATACCACGGTGCTGGCCATCTCCACCGACTCGCACTACTCCCACCTCGCCTGGA
CGGAGCGTCCGCGCAGCCAAGGCGGCCTCGGCAAGGACCTGCAGCTTCCCCTCGTCGCGGACAAGTCGCTCCGCA
TCTCGAAGAGCTATGGCGTGCTGCTCGAGGACGAGGGCATCGCTCTCCGCGGTCTCTTTATCATCGATCCCAAGG
GAATCGTAAGGGTCATCAACATCAATGATCTGCCCGTCGGACGAAGCGTGACCGAGACCATCCGTCTGGTCGAGG
CATTCCAGTTCGTCGAGGAACACGGAGAGGCCTGCCCGGCTGGCTGGAACAAGGGCGCCAAGACGATTAAAGCCG
ATCCTAAGGGGAGCCTCGAGTACTTCTTGGCCACCCACGGCGAGAATGGCCAGGCCAAGGGGAATGGTGAGTCAA
ACAAGCGATTAAGGATGGAGTAGGCGAGACAAAAGGCTCGCAGACGAAGCCACACTCGATGCTTACATGTCGATA
GGGCATGCCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail