Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2660
Gene name
Locationscaffold_216:4228..5035
Strand+
Gene length (bp)807
Transcript length (bp)807
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17784 Sulfotransfer_4 Sulfotransferase domain 2.5E-62 14 228

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 248 267 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 5.54 1.16 9.92
CcL In ants, during behavior modification 702.61 181.35 1223.87
CcD In ants, recently dead 217.98 111.75 324.20

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2660
MERDTKPPAPSQLQVLALGLPRSGTYSMASALSQLGLNKPFHGIDIGMNKKAWAIIDQACDASFPVLDSYNGRPF
TRAQWDELFKDSEAVTDVGALFAPQLIEAYPEARVILVIRDFDSWLRSMEMLFDLIWNPLSTIMSYVVDPLLGIT
VGITVRKLLLGFFEARDVGEARRNASRIFERHHQQIRKMVPPQQLLEYRMGQGWEPICDFLGKPVPETPFPRSND
SEALAKLFWEGKKNSCYAAAKMCLPWLGVISAAAVFVYLSSIV
Coding >Ophio5|2660
ATGGAAAGGGATACGAAGCCGCCGGCACCAAGCCAGCTCCAGGTGCTCGCCCTCGGCCTCCCGAGGAGCGGCACC
TACTCCATGGCCAGCGCTCTCTCACAACTCGGCTTGAATAAGCCCTTTCACGGCATAGACATCGGCATGAACAAA
AAAGCCTGGGCCATCATAGACCAAGCATGCGATGCCTCATTTCCGGTCCTGGACTCCTACAATGGCCGGCCATTC
ACAAGGGCGCAATGGGACGAGCTTTTCAAAGATAGCGAGGCCGTGACCGACGTCGGGGCTCTCTTTGCGCCACAG
CTTATTGAGGCTTACCCTGAGGCCCGTGTCATACTCGTCATCCGTGACTTTGACTCGTGGCTTCGCAGCATGGAA
ATGCTATTCGATCTCATTTGGAATCCTCTTTCCACCATCATGTCTTACGTGGTCGATCCGTTACTTGGGATTACC
GTCGGAATTACCGTCAGAAAGCTTCTGCTTGGGTTTTTCGAGGCCCGCGACGTGGGCGAGGCGCGGCGAAATGCG
TCTAGGATCTTCGAGCGTCACCATCAGCAGATACGCAAGATGGTGCCTCCGCAACAACTGCTGGAATATCGCATG
GGTCAAGGCTGGGAGCCGATTTGTGACTTTCTAGGGAAGCCCGTACCAGAAACCCCTTTTCCGAGGTCTAACGAT
TCCGAAGCGCTGGCAAAGCTCTTCTGGGAGGGAAAAAAAAACAGCTGTTACGCCGCCGCCAAGATGTGCCTGCCA
TGGCTCGGAGTCATATCTGCCGCCGCTGTTTTTGTCTACCTATCCTCGATCGTC
Transcript >Ophio5|2660
ATGGAAAGGGATACGAAGCCGCCGGCACCAAGCCAGCTCCAGGTGCTCGCCCTCGGCCTCCCGAGGAGCGGCACC
TACTCCATGGCCAGCGCTCTCTCACAACTCGGCTTGAATAAGCCCTTTCACGGCATAGACATCGGCATGAACAAA
AAAGCCTGGGCCATCATAGACCAAGCATGCGATGCCTCATTTCCGGTCCTGGACTCCTACAATGGCCGGCCATTC
ACAAGGGCGCAATGGGACGAGCTTTTCAAAGATAGCGAGGCCGTGACCGACGTCGGGGCTCTCTTTGCGCCACAG
CTTATTGAGGCTTACCCTGAGGCCCGTGTCATACTCGTCATCCGTGACTTTGACTCGTGGCTTCGCAGCATGGAA
ATGCTATTCGATCTCATTTGGAATCCTCTTTCCACCATCATGTCTTACGTGGTCGATCCGTTACTTGGGATTACC
GTCGGAATTACCGTCAGAAAGCTTCTGCTTGGGTTTTTCGAGGCCCGCGACGTGGGCGAGGCGCGGCGAAATGCG
TCTAGGATCTTCGAGCGTCACCATCAGCAGATACGCAAGATGGTGCCTCCGCAACAACTGCTGGAATATCGCATG
GGTCAAGGCTGGGAGCCGATTTGTGACTTTCTAGGGAAGCCCGTACCAGAAACCCCTTTTCCGAGGTCTAACGAT
TCCGAAGCGCTGGCAAAGCTCTTCTGGGAGGGAAAAAAAAACAGCTGTTACGCCGCCGCCAAGATGTGCCTGCCA
TGGCTCGGAGTCATATCTGCCGCCGCTGTTTTTGTCTACCTATCCTCGATCGTCTAG
Gene >Ophio5|2660
ATGGAAAGGGATACGAAGCCGCCGGCACCAAGCCAGCTCCAGGTGCTCGCCCTCGGCCTCCCGAGGAGCGGCACC
TACTCCATGGCCAGCGCTCTCTCACAACTCGGCTTGAATAAGCCCTTTCACGGCATAGACATCGGCATGAACAAA
AAAGCCTGGGCCATCATAGACCAAGCATGCGATGCCTCATTTCCGGTCCTGGACTCCTACAATGGCCGGCCATTC
ACAAGGGCGCAATGGGACGAGCTTTTCAAAGATAGCGAGGCCGTGACCGACGTCGGGGCTCTCTTTGCGCCACAG
CTTATTGAGGCTTACCCTGAGGCCCGTGTCATACTCGTCATCCGTGACTTTGACTCGTGGCTTCGCAGCATGGAA
ATGCTATTCGATCTCATTTGGAATCCTCTTTCCACCATCATGTCTTACGTGGTCGATCCGTTACTTGGGATTACC
GTCGGAATTACCGTCAGAAAGCTTCTGCTTGGGTTTTTCGAGGCCCGCGACGTGGGCGAGGCGCGGCGAAATGCG
TCTAGGATCTTCGAGCGTCACCATCAGCAGATACGCAAGATGGTGCCTCCGCAACAACTGCTGGAATATCGCATG
GGTCAAGGCTGGGAGCCGATTTGTGACTTTCTAGGGAAGCCCGTACCAGAAACCCCTTTTCCGAGGTCTAACGAT
TCCGAAGCGCTGGCAAAGCTCTTCTGGGAGGGAAAAAAAAACAGCTGTTACGCCGCCGCCAAGATGTGCCTGCCA
TGGCTCGGAGTCATATCTGCCGCCGCTGTTTTTGTCTACCTATCCTCGATCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail