Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|266
Gene name
Locationscaffold_1056:301..2271
Strand+
Gene length (bp)1970
Transcript length (bp)1515
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 1.3E-46 181 495
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 1.1E-25 184 491
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 8.8E-05 79 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 27 503 3.0E-60
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 84 503 2.0E-55
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 99 503 3.0E-55
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 98 503 5.0E-55
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 98 503 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 27 503 3.0E-60
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 84 503 2.0E-55
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 99 503 3.0E-55
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 98 503 5.0E-55
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 98 503 1.0E-54
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 80 499 1.0E-52
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 98 503 2.0E-52
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 98 503 5.0E-52
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 27 503 9.0E-51
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 178 503 4.0E-49
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 178 503 6.0E-49
sp|Q9LEW0|UBP22_ARATH Ubiquitin carboxyl-terminal hydrolase 22 OS=Arabidopsis thaliana GN=UBP22 PE=2 SV=1 82 491 2.0E-48
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 82 503 3.0E-46
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 102 493 4.0E-29
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 102 493 4.0E-28
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp16 PE=1 SV=1 181 503 2.0E-27
sp|Q9SB51|UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana GN=UBP16 PE=1 SV=1 181 502 2.0E-25
sp|Q5RBQ4|UBP46_PONAB Ubiquitin carboxyl-terminal hydrolase 46 OS=Pongo abelii GN=USP46 PE=2 SV=1 181 492 3.0E-24
sp|P62069|UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus GN=Usp46 PE=1 SV=1 181 492 3.0E-24
sp|P62068|UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens GN=USP46 PE=1 SV=1 181 492 3.0E-24
sp|A5D9H7|UBP12_BOVIN Ubiquitin carboxyl-terminal hydrolase 12 OS=Bos taurus GN=USP12 PE=2 SV=1 181 492 4.0E-23
sp|A5WWB0|UBP46_DANRE Ubiquitin carboxyl-terminal hydrolase 46 OS=Danio rerio GN=usp46 PE=3 SV=2 181 492 5.0E-23
sp|O00507|USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens GN=USP9Y PE=2 SV=2 178 498 8.0E-23
sp|D3ZU96|UBP42_RAT Ubiquitin carboxyl-terminal hydrolase 42 OS=Rattus norvegicus GN=Usp42 PE=1 SV=1 181 503 1.0E-22
sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens GN=USP24 PE=1 SV=3 176 498 2.0E-22
sp|Q93008|USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens GN=USP9X PE=1 SV=3 178 498 2.0E-22
sp|B2RQC2|UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus GN=Usp42 PE=1 SV=1 181 503 2.0E-22
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 181 503 2.0E-22
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 181 503 3.0E-22
sp|B1AY13|UBP24_MOUSE Ubiquitin carboxyl-terminal hydrolase 24 OS=Mus musculus GN=Usp24 PE=1 SV=1 176 498 3.0E-22
sp|Q7M764|U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus GN=Usp17le PE=3 SV=2 181 502 4.0E-22
sp|Q5M981|UB12B_XENLA Ubiquitin carboxyl-terminal hydrolase 12-B OS=Xenopus laevis GN=usp12-b PE=2 SV=2 181 492 5.0E-22
sp|Q8LAM0|UBP4_ARATH Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana GN=UBP4 PE=1 SV=2 181 499 5.0E-22
sp|Q9D9M2|UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus GN=Usp12 PE=2 SV=2 181 492 6.0E-22
sp|Q52KZ6|UB12A_XENLA Ubiquitin carboxyl-terminal hydrolase 12-A OS=Xenopus laevis GN=usp12-a PE=2 SV=1 181 492 6.0E-22
sp|P70398|USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus GN=Usp9x PE=1 SV=2 178 498 9.0E-22
sp|O75317|UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens GN=USP12 PE=1 SV=2 181 492 1.0E-21
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens GN=USP17L2 PE=1 SV=2 181 503 1.0E-21
sp|Q9H9J4|UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens GN=USP42 PE=1 SV=3 181 499 1.0E-21
sp|Q6QN14|U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens GN=USP17L6P PE=1 SV=2 181 503 1.0E-21
sp|E1B9W9|UBP42_BOVIN Ubiquitin carboxyl-terminal hydrolase 42 OS=Bos taurus GN=USP42 PE=3 SV=1 181 499 1.0E-21
sp|A8MUK1|U17L5_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 5 OS=Homo sapiens GN=USP17L5 PE=3 SV=2 181 503 1.0E-21
sp|D6RBQ6|U17LH_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 17 OS=Homo sapiens GN=USP17L17 PE=3 SV=1 181 503 1.0E-21
sp|C9JLJ4|U17LD_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 13 OS=Homo sapiens GN=USP17L13 PE=3 SV=1 181 503 1.0E-21
sp|C9JVI0|U17LB_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 11 OS=Homo sapiens GN=USP17L11 PE=3 SV=1 181 503 2.0E-21
sp|D6RCP7|U17LJ_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 19 OS=Homo sapiens GN=USP17L19 PE=3 SV=1 181 503 2.0E-21
sp|D6R9N7|U17LI_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 18 OS=Homo sapiens GN=USP17L18 PE=3 SV=1 181 503 2.0E-21
sp|Q9FPS2|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25 OS=Arabidopsis thaliana GN=UBP25 PE=2 SV=1 169 503 2.0E-21
sp|D6RJB6|U17LK_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 20 OS=Homo sapiens GN=USP17L20 PE=3 SV=1 181 503 3.0E-21
sp|C9J2P7|U17LF_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 15 OS=Homo sapiens GN=USP17L15 PE=3 SV=1 181 503 3.0E-21
sp|D6R901|U17LL_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 21 OS=Homo sapiens GN=USP17L21 PE=3 SV=1 181 503 3.0E-21
sp|D6RA61|U17LM_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 22 OS=Homo sapiens GN=USP17L22 PE=3 SV=1 181 503 3.0E-21
sp|C9JPN9|UL17C_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 12 OS=Homo sapiens GN=USP17L12 PE=3 SV=1 181 503 3.0E-21
sp|Q0WX57|U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens GN=USP17L24 PE=1 SV=2 181 503 3.0E-21
sp|C0HB46|UBP12_SALSA Ubiquitin carboxyl-terminal hydrolase 12 OS=Salmo salar GN=usp12 PE=2 SV=1 181 492 4.0E-21
sp|A4FUN7|UBP12_DANRE Ubiquitin carboxyl-terminal hydrolase 12A OS=Danio rerio GN=usp12a PE=2 SV=1 181 492 5.0E-21
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 181 502 7.0E-21
sp|P55824|FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster GN=faf PE=1 SV=2 178 491 7.0E-21
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2 180 499 7.0E-21
sp|C9JJH3|U17LA_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 10 OS=Homo sapiens GN=USP17L10 PE=3 SV=1 181 503 8.0E-21
sp|Q86UV5|UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens GN=USP48 PE=1 SV=1 175 492 2.0E-20
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 3 OS=Homo sapiens GN=USP17L3 PE=3 SV=1 181 503 5.0E-20
sp|Q3V0C5|UBP48_MOUSE Ubiquitin carboxyl-terminal hydrolase 48 OS=Mus musculus GN=Usp48 PE=1 SV=2 175 492 5.0E-20
sp|P53874|UBP10_YEAST Ubiquitin carboxyl-terminal hydrolase 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP10 PE=1 SV=2 180 504 5.0E-20
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 178 491 6.0E-20
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 167 499 1.0E-19
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 181 499 1.0E-19
sp|Q7RTZ2|U17L1_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 1 OS=Homo sapiens GN=USP17L1 PE=3 SV=1 181 503 2.0E-19
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 178 490 3.0E-19
sp|B4QIS3|UBP36_DROSI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila simulans GN=Usp36 PE=3 SV=1 181 501 3.0E-19
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 176 499 3.0E-19
sp|P0C7I0|U17L8_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8 OS=Homo sapiens GN=USP17L8 PE=3 SV=1 181 503 3.0E-19
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 178 490 4.0E-19
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 OS=Homo sapiens GN=USP17L4 PE=3 SV=3 181 503 5.0E-19
sp|P50101|UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP15 PE=1 SV=1 173 491 5.0E-19
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 176 499 7.0E-19
sp|Q67XW5|UBP18_ARATH Ubiquitin carboxyl-terminal hydrolase 18 OS=Arabidopsis thaliana GN=UBP18 PE=2 SV=2 181 499 7.0E-19
sp|Q9SJA1|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19 OS=Arabidopsis thaliana GN=UBP19 PE=2 SV=2 181 502 1.0E-18
sp|Q9FPS4|UBP23_ARATH Ubiquitin carboxyl-terminal hydrolase 23 OS=Arabidopsis thaliana GN=UBP23 PE=2 SV=2 181 503 2.0E-18
sp|Q5ZM45|UBP48_CHICK Ubiquitin carboxyl-terminal hydrolase 48 OS=Gallus gallus GN=USP48 PE=2 SV=1 175 492 2.0E-18
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 176 499 2.0E-18
sp|Q9P7V9|UBP9_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp9 PE=1 SV=1 262 491 3.0E-18
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 176 491 3.0E-18
sp|B3NC86|UBP36_DROER Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila erecta GN=Usp36 PE=3 SV=1 181 501 4.0E-18
sp|Q9UTT1|UBP21_SCHPO Ubiquitin carboxyl-terminal hydrolase 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp21 PE=3 SV=2 172 500 5.0E-18
sp|B3M3M6|UBP36_DROAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila ananassae GN=Usp36 PE=3 SV=1 181 501 7.0E-18
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 176 488 1.0E-17
sp|B4PIW8|UBP36_DROYA Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila yakuba GN=Usp36 PE=3 SV=1 181 501 1.0E-17
sp|Q76LT8|UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus GN=Usp48 PE=1 SV=1 175 492 2.0E-17
sp|Q84WU2|UBP13_ARATH Ubiquitin carboxyl-terminal hydrolase 13 OS=Arabidopsis thaliana GN=UBP13 PE=1 SV=1 173 491 3.0E-17
sp|Q9FPT1|UBP12_ARATH Ubiquitin carboxyl-terminal hydrolase 12 OS=Arabidopsis thaliana GN=UBP12 PE=1 SV=2 173 491 3.0E-17
sp|Q9VRP5|UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster GN=scny PE=1 SV=3 181 501 4.0E-17
sp|Q9FIQ1|UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana GN=UBP21 PE=2 SV=1 181 491 6.0E-17
sp|B4LG38|UBP36_DROVI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila virilis GN=Usp36 PE=3 SV=1 181 501 8.0E-17
sp|Q9FKP5|UBP17_ARATH Ubiquitin carboxyl-terminal hydrolase 17 OS=Arabidopsis thaliana GN=UBP17 PE=2 SV=1 181 491 9.0E-17
sp|P34547|UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans GN=usp-46 PE=1 SV=3 181 499 9.0E-17
sp|B4MLR8|UBP36_DROWI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila willistoni GN=Usp36 PE=3 SV=1 181 500 1.0E-16
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 181 501 1.0E-16
sp|B4IXE0|UBP36_DROGR Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila grimshawi GN=Usp36 PE=3 SV=1 181 501 2.0E-16
sp|B4KXJ5|UBP36_DROMO Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila mojavensis GN=Usp36 PE=3 SV=1 181 501 2.0E-16
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 304 503 3.0E-16
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 304 503 4.0E-16
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 304 503 5.0E-16
sp|Q09879|UBP5_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp5 PE=3 SV=3 176 502 8.0E-16
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 176 503 1.0E-15
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 287 491 1.0E-15
sp|B1WBD7|UBP20_XENLA Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus laevis GN=usp20 PE=2 SV=1 287 491 1.0E-15
sp|Q0CT11|CREB_ASPTN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=creB PE=3 SV=2 232 492 1.0E-15
sp|P38187|UBP13_YEAST Ubiquitin carboxyl-terminal hydrolase 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP13 PE=1 SV=3 266 492 1.0E-15
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 176 503 2.0E-15
sp|B8NSV5|CREB_ASPFN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creB PE=3 SV=1 220 492 2.0E-15
sp|Q2UUG8|CREB_ASPOR Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creB PE=3 SV=2 220 492 2.0E-15
sp|A3AF13|UBP26_ORYSJ Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza sativa subsp. japonica GN=UBP26 PE=3 SV=2 181 491 3.0E-15
sp|A2XDG4|UBP26_ORYSI Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza sativa subsp. indica GN=UBP26 PE=3 SV=1 181 491 3.0E-15
sp|Q9NVE5|UBP40_HUMAN Ubiquitin carboxyl-terminal hydrolase 40 OS=Homo sapiens GN=USP40 PE=1 SV=3 179 478 3.0E-15
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 176 503 3.0E-15
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 176 503 3.0E-15
sp|Q96V54|CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creB PE=1 SV=1 220 492 5.0E-15
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 304 503 9.0E-15
sp|A2Q9N1|CREB_ASPNC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creB PE=3 SV=2 220 492 1.0E-14
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 304 503 1.0E-14
sp|Q7JKC3|UBP7_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans GN=usp-7 PE=3 SV=1 167 498 1.0E-14
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 269 503 1.0E-14
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 304 491 1.0E-14
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 298 491 1.0E-14
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 304 503 2.0E-14
sp|P39967|UBP9_YEAST Ubiquitin carboxyl-terminal hydrolase 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP9 PE=1 SV=1 266 492 2.0E-14
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 304 503 2.0E-14
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 304 491 2.0E-14
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 304 503 2.0E-14
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 269 503 2.0E-14
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 304 491 3.0E-14
sp|B0Y4P5|CREB_ASPFC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creB PE=3 SV=1 258 492 3.0E-14
sp|Q8BWR4|UBP40_MOUSE Ubiquitin carboxyl-terminal hydrolase 40 OS=Mus musculus GN=Usp40 PE=1 SV=2 179 478 3.0E-14
sp|Q4WQI1|CREB_ASPFU Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creB PE=3 SV=3 258 492 3.0E-14
sp|Q60MK8|UBP7_CAEBR Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis briggsae GN=usp-7 PE=3 SV=1 167 498 3.0E-14
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 269 503 3.0E-14
sp|A1CW53|CREB_NEOFI Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creB PE=3 SV=2 258 492 3.0E-14
sp|A1CIL1|CREB_ASPCL Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creB PE=3 SV=2 258 492 7.0E-14
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 304 503 2.0E-13
sp|P39944|UBP5_YEAST Ubiquitin carboxyl-terminal hydrolase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP5 PE=1 SV=1 181 488 2.0E-13
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 298 491 4.0E-13
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 304 499 6.0E-13
sp|Q9FPS7|UBP20_ARATH Ubiquitin carboxyl-terminal hydrolase 20 OS=Arabidopsis thaliana GN=UBP20 PE=2 SV=1 181 491 7.0E-13
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 304 503 1.0E-12
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 347 502 1.0E-12
sp|Q70EL3|UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens GN=USP50 PE=2 SV=1 178 478 1.0E-12
sp|B4HUI5|UBP36_DROSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila sechellia GN=Usp36 PE=3 SV=1 181 501 2.0E-12
sp|Q9WTV6|UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus GN=Usp18 PE=1 SV=2 163 499 3.0E-12
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 347 502 3.0E-12
sp|Q3LFD5|UBP41_HUMAN Putative ubiquitin carboxyl-terminal hydrolase 41 OS=Homo sapiens GN=USP41 PE=2 SV=2 176 499 3.0E-12
sp|Q5U252|UBP47_XENLA Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopus laevis GN=usp47 PE=2 SV=1 139 499 3.0E-12
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 352 502 5.0E-12
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 375 502 5.0E-12
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 304 477 6.0E-12
sp|Q9SCJ9|UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 26 OS=Arabidopsis thaliana GN=UBP26 PE=1 SV=3 181 491 7.0E-12
sp|Q70CQ2|UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens GN=USP34 PE=1 SV=2 164 492 1.0E-11
sp|A1A5G2|UBP47_XENTR Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopus tropicalis GN=usp47 PE=2 SV=1 178 499 1.0E-11
sp|Q5RE63|UBP18_PONAB Ubl carboxyl-terminal hydrolase 18 OS=Pongo abelii GN=USP18 PE=2 SV=1 177 499 2.0E-11
sp|Q9UMW8|UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens GN=USP18 PE=1 SV=1 177 499 2.0E-11
sp|A6ZY34|UBP4_YEAS7 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DOA4 PE=3 SV=1 181 490 3.0E-11
sp|P32571|UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA4 PE=1 SV=2 181 490 3.0E-11
sp|Q6ZQ93|UBP34_MOUSE Ubiquitin carboxyl-terminal hydrolase 34 OS=Mus musculus GN=Usp34 PE=1 SV=3 164 492 4.0E-11
sp|O60139|UBP4_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp4 PE=1 SV=2 157 499 4.0E-11
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 347 502 5.0E-11
sp|Q754R5|UBP4_ASHGO Ubiquitin carboxyl-terminal hydrolase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DOA4 PE=3 SV=2 140 488 5.0E-11
sp|B3LGK1|UBP4_YEAS1 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DOA4 PE=3 SV=1 181 490 5.0E-11
sp|Q9UUD6|UBP11_SCHPO Ubiquitin carboxyl-terminal hydrolase 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp11 PE=3 SV=1 178 498 8.0E-11
sp|Q6U7I1|UBP7_CHICK Ubiquitin carboxyl-terminal hydrolase 7 OS=Gallus gallus GN=USP7 PE=2 SV=1 173 491 2.0E-10
sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=2 SV=2 365 502 2.0E-10
sp|Q6A4J8|UBP7_MOUSE Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus GN=Usp7 PE=1 SV=1 173 491 1.0E-09
sp|Q4VSI4|UBP7_RAT Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus GN=Usp7 PE=1 SV=1 173 491 2.0E-09
sp|Q93009|UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens GN=USP7 PE=1 SV=2 173 491 2.0E-09
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 363 492 3.0E-09
sp|Q96K76|UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens GN=USP47 PE=1 SV=3 178 499 3.0E-09
sp|Q9VYQ8|UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster GN=Usp7 PE=1 SV=1 173 491 3.0E-09
sp|E1C1R4|UBP47_CHICK Ubiquitin carboxyl-terminal hydrolase 47 OS=Gallus gallus GN=USP47 PE=3 SV=1 178 499 3.0E-09
sp|Q8BY87|UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus GN=Usp47 PE=1 SV=2 164 499 3.0E-09
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 365 492 1.0E-08
sp|A7TGY3|UBP4_VANPO Ubiquitin carboxyl-terminal hydrolase 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DOA4 PE=3 SV=1 269 488 2.0E-08
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 353 502 3.0E-08
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 353 502 4.0E-08
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 353 502 4.0E-08
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 375 502 5.0E-08
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 353 502 6.0E-08
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 352 502 1.0E-07
sp|O22207|UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana GN=UBP5 PE=1 SV=2 357 499 1.0E-07
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 375 502 4.0E-07
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 342 491 4.0E-07
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 348 491 4.0E-07
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 347 491 4.0E-07
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 176 359 5.0E-07
sp|Q86T82|UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens GN=USP37 PE=1 SV=2 181 408 6.0E-07
sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2 302 503 7.0E-07
sp|Q3TIX9|SNUT2_MOUSE U4/U6.U5 tri-snRNP-associated protein 2 OS=Mus musculus GN=Usp39 PE=1 SV=2 178 491 7.0E-07
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 375 501 1.0E-06
sp|Q53GS9|SNUT2_HUMAN U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens GN=USP39 PE=1 SV=2 178 491 2.0E-06
sp|Q24574|UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 64E OS=Drosophila melanogaster GN=Ubp64E PE=1 SV=2 128 438 2.0E-06
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 357 501 2.0E-06
sp|Q29RP1|UBP1_BOVIN Ubiquitin carboxyl-terminal hydrolase 1 OS=Bos taurus GN=USP1 PE=2 SV=1 296 481 2.0E-06
sp|E2RK09|UBP37_CANLF Ubiquitin carboxyl-terminal hydrolase 37 OS=Canis lupus familiaris GN=USP37 PE=3 SV=1 181 408 2.0E-06
sp|Q5R761|SNUT2_PONAB U4/U6.U5 tri-snRNP-associated protein 2 OS=Pongo abelii GN=USP39 PE=2 SV=1 178 491 2.0E-06
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 354 491 3.0E-06
sp|F1N5V1|UBP37_BOVIN Ubiquitin carboxyl-terminal hydrolase 37 OS=Bos taurus GN=USP37 PE=3 SV=1 181 408 4.0E-06
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 357 499 6.0E-06
sp|Q569C3|UBP1_RAT Ubiquitin carboxyl-terminal hydrolase 1 OS=Rattus norvegicus GN=Usp1 PE=1 SV=1 296 481 6.0E-06
sp|Q8BJQ2|UBP1_MOUSE Ubiquitin carboxyl-terminal hydrolase 1 OS=Mus musculus GN=Usp1 PE=1 SV=1 296 481 6.0E-06
sp|Q5UQR3|UBPL1_MIMIV Probable ubiquitin carboxyl-terminal hydrolase R319 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R319 PE=3 SV=1 305 488 9.0E-06
sp|O94782|UBP1_HUMAN Ubiquitin carboxyl-terminal hydrolase 1 OS=Homo sapiens GN=USP1 PE=1 SV=1 296 481 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0046872 metal ion binding No
GO:0101005 deubiquitinase activity No
GO:0043412 macromolecule modification No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0070646 protein modification by small protein removal No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0019538 protein metabolic process No
GO:0036211 protein modification process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0003824 catalytic activity No
GO:0008234 cysteine-type peptidase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2705 0.8902 0.1045 0.0067 0.0404 0.0005 0.0859 0.044 0.0442 0.0027

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5321
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2387
Ophiocordyceps australis map64 (Brazil) OphauB2|5657
Ophiocordyceps camponoti-floridani Ophcf2|00082
Ophiocordyceps camponoti-rufipedis Ophun1|6614
Ophiocordyceps kimflemingae Ophio5|266 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|266
MSTASNTPASPKNVKVKSPSPGTPMFGCEHVQLLLSQGQEVMNSSIAHYKMILRGIFDATPIVPQTSTNHEGRPI
TCLTSNYLCLQCPTTVSEQDRLKHGSKRSHRFYVDSRNGSLYCQICDDLVWDPTLEELRVRKIGTGSFSGRKRKH
DELFADSVKDDPRYISANTVTSSCRANGLRGIYNAGATCYQNVVLQSFLHNPLLRNFYLSDGHQSNDCQVQHCLS
CAIDDMFQDFYALENTNGYTAANILSGFWISEKKAFENLVTTKEQDAHEFFQFLAEELHERNGDGKRPEIGSEHS
CNCIIHQTFYGKMQTTTTCQNCKGTTHAVQSFLDLSLGLENLAQKRVKKNNQKMPILALTDCLDEEYVKFDKCEY
RCHSCVSSQQAKRYTSIKRLPNVLSIQLKRFEYKQGRHDRAASKIDNAVQFPLQLNMLPYTNRVRSRESRENLEL
ERSCTYDLLSVVVHVGEIETGHYVSYCRVGDQWFKFNDHKVELASVSDICNKEP
Coding >Ophio5|266
ATGTCCACGGCGTCAAACACACCAGCATCCCCCAAAAATGTCAAGGTTAAATCGCCGTCTCCAGGAACACCAATG
TTTGGCTGCGAACATGTTCAGCTTCTGCTTTCGCAGGGTCAAGAGGTCATGAACAGCTCAATAGCACACTACAAG
ATGATACTGCGAGGCATCTTTGACGCGACTCCTATCGTGCCCCAGACATCTACGAACCATGAGGGACGACCAATT
ACATGCTTGACGTCGAACTATCTCTGTCTACAGTGCCCAACGACTGTTTCTGAGCAGGATCGCCTGAAGCACGGC
TCCAAGAGATCTCATCGCTTTTACGTGGATTCACGAAATGGCTCTCTTTATTGCCAAATATGCGATGATTTGGTG
TGGGATCCGACCCTTGAAGAGCTTCGCGTGCGCAAAATCGGAACAGGATCCTTCTCAGGTCGGAAGAGGAAACAT
GATGAGTTGTTCGCCGACTCGGTGAAAGACGATCCTCGTTACATCAGCGCCAATACCGTAACGTCTTCTTGCCGG
GCCAATGGTCTCCGTGGTATCTACAATGCTGGGGCAACATGTTATCAAAATGTCGTGCTGCAAAGTTTCCTGCAT
AATCCCCTGCTGCGCAATTTTTACTTAAGTGACGGGCACCAAAGCAACGACTGCCAGGTTCAACATTGTCTTAGT
TGTGCCATTGATGACATGTTTCAGGACTTCTACGCATTAGAGAACACAAATGGCTATACGGCGGCCAACATCCTC
TCCGGGTTTTGGATATCCGAGAAGAAGGCTTTTGAGAACCTCGTTACGACTAAGGAACAAGATGCTCACGAATTT
TTCCAGTTCTTGGCTGAGGAGCTCCATGAGCGCAATGGAGACGGAAAGAGGCCAGAAATTGGAAGCGAACATAGC
TGCAACTGCATTATTCACCAGACGTTTTATGGCAAAATGCAGACAACCACAACATGCCAAAACTGCAAGGGTACG
ACCCATGCTGTCCAGTCTTTCCTAGATCTTAGTCTCGGACTGGAAAACCTGGCTCAGAAGCGAGTTAAGAAAAAC
AATCAAAAAATGCCAATCTTAGCCCTGACCGACTGTTTGGACGAGGAATACGTCAAATTCGACAAGTGCGAGTAC
CGATGCCACAGCTGTGTCTCTTCGCAACAGGCCAAGAGATACACGAGTATCAAGCGTTTGCCAAACGTGCTGTCC
ATTCAGCTGAAGCGATTTGAGTATAAGCAGGGAAGACATGACCGAGCGGCGTCCAAGATCGATAATGCTGTCCAA
TTCCCTCTCCAGCTCAATATGCTTCCCTATACGAATCGCGTCCGCAGTCGCGAGAGCCGCGAAAATTTGGAGCTT
GAAAGGTCATGCACATACGATCTTCTCAGCGTCGTGGTGCACGTAGGAGAGATTGAGACTGGCCATTATGTCTCG
TACTGCCGCGTTGGCGACCAGTGGTTTAAGTTCAACGATCACAAGGTCGAATTGGCCAGTGTATCTGACATATGC
AATAAAGAGCCT
Transcript >Ophio5|266
ATGTCCACGGCGTCAAACACACCAGCATCCCCCAAAAATGTCAAGGTTAAATCGCCGTCTCCAGGAACACCAATG
TTTGGCTGCGAACATGTTCAGCTTCTGCTTTCGCAGGGTCAAGAGGTCATGAACAGCTCAATAGCACACTACAAG
ATGATACTGCGAGGCATCTTTGACGCGACTCCTATCGTGCCCCAGACATCTACGAACCATGAGGGACGACCAATT
ACATGCTTGACGTCGAACTATCTCTGTCTACAGTGCCCAACGACTGTTTCTGAGCAGGATCGCCTGAAGCACGGC
TCCAAGAGATCTCATCGCTTTTACGTGGATTCACGAAATGGCTCTCTTTATTGCCAAATATGCGATGATTTGGTG
TGGGATCCGACCCTTGAAGAGCTTCGCGTGCGCAAAATCGGAACAGGATCCTTCTCAGGTCGGAAGAGGAAACAT
GATGAGTTGTTCGCCGACTCGGTGAAAGACGATCCTCGTTACATCAGCGCCAATACCGTAACGTCTTCTTGCCGG
GCCAATGGTCTCCGTGGTATCTACAATGCTGGGGCAACATGTTATCAAAATGTCGTGCTGCAAAGTTTCCTGCAT
AATCCCCTGCTGCGCAATTTTTACTTAAGTGACGGGCACCAAAGCAACGACTGCCAGGTTCAACATTGTCTTAGT
TGTGCCATTGATGACATGTTTCAGGACTTCTACGCATTAGAGAACACAAATGGCTATACGGCGGCCAACATCCTC
TCCGGGTTTTGGATATCCGAGAAGAAGGCTTTTGAGAACCTCGTTACGACTAAGGAACAAGATGCTCACGAATTT
TTCCAGTTCTTGGCTGAGGAGCTCCATGAGCGCAATGGAGACGGAAAGAGGCCAGAAATTGGAAGCGAACATAGC
TGCAACTGCATTATTCACCAGACGTTTTATGGCAAAATGCAGACAACCACAACATGCCAAAACTGCAAGGGTACG
ACCCATGCTGTCCAGTCTTTCCTAGATCTTAGTCTCGGACTGGAAAACCTGGCTCAGAAGCGAGTTAAGAAAAAC
AATCAAAAAATGCCAATCTTAGCCCTGACCGACTGTTTGGACGAGGAATACGTCAAATTCGACAAGTGCGAGTAC
CGATGCCACAGCTGTGTCTCTTCGCAACAGGCCAAGAGATACACGAGTATCAAGCGTTTGCCAAACGTGCTGTCC
ATTCAGCTGAAGCGATTTGAGTATAAGCAGGGAAGACATGACCGAGCGGCGTCCAAGATCGATAATGCTGTCCAA
TTCCCTCTCCAGCTCAATATGCTTCCCTATACGAATCGCGTCCGCAGTCGCGAGAGCCGCGAAAATTTGGAGCTT
GAAAGGTCATGCACATACGATCTTCTCAGCGTCGTGGTGCACGTAGGAGAGATTGAGACTGGCCATTATGTCTCG
TACTGCCGCGTTGGCGACCAGTGGTTTAAGTTCAACGATCACAAGGTCGAATTGGCCAGTGTATCTGACATATGC
AATAAAGAGCCTTGA
Gene >Ophio5|266
ATGTCCACGGCGTCAAACACACCAGCATCCCCCAAAAATGTCAAGGTTAAATCGCCGTCTCCAGGAACACCAATG
TTTGGCTGCGGTACGTGTGCCGCCGTTGGGACAATTCTGGACTCGGCCTTTCTGTCATTGACTCAGAAATAATTC
TCTAGAACATGTTCAGCTTCTGCTTTCGCAGGGTCAAGAGGTCATGAACAGCTCAATAGCACACTACAAGATGAT
ACTGCGAGGCATCTTTGACGCGACTCCTATCGTGCCCCAGACATCTACGAACCATGAGGGACGACCAATTACATG
CTTGACGTCGAACTATCTCTGTCTACAGTGCCCAACGACTGTTTCTGAGCAGGATCGCCTGAAGCACGGCTCCAA
GAGATCTCATCGCTTTTGTACGCATCCCAAAGTGTCATCTCCCAGCTCGTTTGAGCACAGTGAAGAATAGTGCTA
AACTTTGGCAGACGTGGATTCACGAAATGGCTCTCTTTATTGCCAAATATGCGATGATTTGGTGTGGGATCCGAC
CCTTGAAGAGCTTCGCGTGCGCAAAATCGGAACAGGATCCTTCTCAGGTTCGTGCGCCGAGCACCCATCTCCGGG
CTTAATCGAAGATTTGTAACTGTCTTCTTCCAGGTCGGAAGAGGAAACATGATGAGTTGTTCGCCGACTCGGTGA
AAGACGATCCTCGTTACATCAGCGCCAATACCGTAACGTCTTCTTGCCGGGCCAATGGTCTCCGTGGTATCTACA
ATGCTGGGGCAACATGTTATCAAAATGTCGTGCTGCAAAGTTTCCTGCATAATCCCCTGCTGCGCAATTTTTACT
TAAGTGACGGGCACCAAAGCAACGACTGCCAGGTTCAACATTGTCTTAGTTGTGCCATTGATGACATGTTTCAGG
ACTTCTACGCATTAGAGAACACAAATGGCTATACGGCGGCCAACATCCTCTCCGGGTTTTGGATATCCGAGAAGA
AGGCTTTTGAGAACCTCGTTACGACTAAGGAACAAGATGCTCACGAATTTTTCCAGTTCTTGGCTGAGGAGCTCC
ATGAGCGCAATGGAGACGGAAAGAGGCCAGAAATTGGAAGCGAACATAGCTGCAACTGCATTATTCACCAGACGT
TTTATGGCAAAATGCAGACAACCACAACATGCCAAAACTGCAAGGGTACGACCCATGCTGTCCAGTCTTTCCTAG
ATCTTAGTCTCGGACTGGAAAACCTGGCTCAGAAGCGAGTTAAGAAAAACAATCAAAAAATGCCAATCTTAGCCC
TGACCGACTGTTTGGACGAGGAATACGTCAAATTCGACAAGTGCGAGTACCGATGCCACAGCTGTGTCTCTTCGC
AACAGGCCAAGAGATACACGAGTATCAAGCGTTTGCCAAACGTGCTGTCCATTCAGCTGAAGGTAGCAACGGTCT
GCCGAAACATTGCGAACTTCCGGGCACGTTCGCTGACAAAGATTCTGACAGCGATTTGAGTATAAGCAGGGAAGA
CATGACCGAGCGGCGTCCAAGATCGATAATGCTGTCCAATTCCCTCTCCAGCTCAATATGCTTCCCTATACGAAT
CGCGTCCGCAGTCGCGAGAGCCGCGAAAATTTGGAGCTTGAAAGGTCATGCACATACGATCTTCTCAGCGTCGTG
GTGCACGTAGGAGAGATTGAGACTGGCCATTATGTCTCGTACTGCCGCGTTGGCGACCAGGTGAGGATAGCTGTT
CTTGCCGCCAAATTCCGGCAAGAAATGCTGACAGAGACTTCGGTGTCTTGCAGTGGTTTAAGTTCAACGATCACA
AGGTCGAATTGGCCAGTGTATCTGACGTTCTCGGTGCCCAGGCGTATCTATTGTTCTACATAATAAGGGCTCTCA
CTTAGATATGCAATAAAGAGGTAAGTCGGTGAAGAACGAGGAAGTGGGTGGTAAATGCCAAGATTCTAAGTTAAC
AGCGAAATCCTAAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail