Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2653
Gene name
Locationscaffold_215:21679..22654
Strand-
Gene length (bp)975
Transcript length (bp)975
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 66 88 22
3 97 119 22
4 134 156 22
5 177 199 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1.38 0.00 2.82
CcL In ants, during behavior modification 3.89 0.55 7.22
CcD In ants, recently dead 2.28 0.16 4.40

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.029109 yes
SC16a CcD 0.326083 no
CcL CcD 0.244634 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2653
MIVFISIALYNVLELNFLIANTFKKYQGLYFWSLIVATWGIALNAIGYLLRILQSDHSGYGHSTIILVGWCTMVT
GQSLVLYSRLHFVLHNTTVLRGILILIIVDAIWLGVPVIVFVYGSNSDKSKLFIGPYAIFERIQLCVFTVQELII
SGFYIVETSKTLKLQRRVGLAPLDARRGMAHLILANILIVLLDVSVLVLEFSGNYDIQTAWKPLVYSIKLKVEFS
VLNRLVEFSQHMRTGSLAKMGSDTDKGASLGGMTMAASESPTEARYSVHVGTSQSHEINVNDNDEFCVVKTTDVY
IDSSDNSASGGSSRDSTGLGTEPV
Coding >Ophio5|2653
ATGATCGTCTTCATCAGCATCGCTCTCTACAACGTGCTGGAGCTAAACTTCCTGATCGCCAACACCTTCAAGAAA
TACCAGGGCCTGTACTTTTGGAGCCTGATCGTGGCGACATGGGGAATCGCTCTCAACGCCATTGGCTACCTGCTG
CGCATCTTGCAGTCTGATCACTCAGGCTATGGCCATTCCACCATCATCCTCGTCGGCTGGTGCACCATGGTGACG
GGACAGTCGCTGGTCCTGTATTCACGCCTGCATTTCGTCTTGCACAACACGACGGTGCTGCGTGGCATCCTCATC
TTGATCATCGTAGATGCCATTTGGCTGGGCGTCCCCGTCATCGTCTTCGTTTACGGCTCCAACAGCGACAAGTCC
AAGCTTTTTATCGGGCCGTATGCCATCTTCGAGAGGATCCAGCTGTGCGTCTTCACGGTGCAGGAACTCATCATC
TCCGGCTTCTATATCGTCGAGACATCCAAGACACTGAAGCTCCAGAGGCGTGTGGGTTTAGCGCCTCTCGACGCG
CGCCGTGGCATGGCCCATCTCATCCTGGCCAACATACTCATAGTCCTGCTCGATGTGAGCGTCCTGGTGCTCGAG
TTCAGCGGAAACTACGACATTCAGACGGCGTGGAAGCCGCTGGTGTACAGCATCAAGCTCAAGGTCGAGTTCAGT
GTACTGAACCGGCTCGTCGAGTTTTCACAGCACATGAGGACAGGGAGTCTAGCCAAGATGGGTTCGGACACGGAC
AAGGGCGCCTCTCTCGGCGGCATGACCATGGCCGCCTCCGAGTCGCCGACGGAAGCGCGATACAGCGTCCATGTC
GGCACGTCTCAGAGCCACGAGATCAACGTGAACGACAACGACGAATTCTGCGTTGTCAAGACCACCGACGTCTAC
ATCGATAGCTCAGACAACTCGGCTAGCGGCGGCAGCTCCCGCGACTCTACCGGCCTTGGCACCGAACCAGTA
Transcript >Ophio5|2653
ATGATCGTCTTCATCAGCATCGCTCTCTACAACGTGCTGGAGCTAAACTTCCTGATCGCCAACACCTTCAAGAAA
TACCAGGGCCTGTACTTTTGGAGCCTGATCGTGGCGACATGGGGAATCGCTCTCAACGCCATTGGCTACCTGCTG
CGCATCTTGCAGTCTGATCACTCAGGCTATGGCCATTCCACCATCATCCTCGTCGGCTGGTGCACCATGGTGACG
GGACAGTCGCTGGTCCTGTATTCACGCCTGCATTTCGTCTTGCACAACACGACGGTGCTGCGTGGCATCCTCATC
TTGATCATCGTAGATGCCATTTGGCTGGGCGTCCCCGTCATCGTCTTCGTTTACGGCTCCAACAGCGACAAGTCC
AAGCTTTTTATCGGGCCGTATGCCATCTTCGAGAGGATCCAGCTGTGCGTCTTCACGGTGCAGGAACTCATCATC
TCCGGCTTCTATATCGTCGAGACATCCAAGACACTGAAGCTCCAGAGGCGTGTGGGTTTAGCGCCTCTCGACGCG
CGCCGTGGCATGGCCCATCTCATCCTGGCCAACATACTCATAGTCCTGCTCGATGTGAGCGTCCTGGTGCTCGAG
TTCAGCGGAAACTACGACATTCAGACGGCGTGGAAGCCGCTGGTGTACAGCATCAAGCTCAAGGTCGAGTTCAGT
GTACTGAACCGGCTCGTCGAGTTTTCACAGCACATGAGGACAGGGAGTCTAGCCAAGATGGGTTCGGACACGGAC
AAGGGCGCCTCTCTCGGCGGCATGACCATGGCCGCCTCCGAGTCGCCGACGGAAGCGCGATACAGCGTCCATGTC
GGCACGTCTCAGAGCCACGAGATCAACGTGAACGACAACGACGAATTCTGCGTTGTCAAGACCACCGACGTCTAC
ATCGATAGCTCAGACAACTCGGCTAGCGGCGGCAGCTCCCGCGACTCTACCGGCCTTGGCACCGAACCAGTATAG
Gene >Ophio5|2653
ATGATCGTCTTCATCAGCATCGCTCTCTACAACGTGCTGGAGCTAAACTTCCTGATCGCCAACACCTTCAAGAAA
TACCAGGGCCTGTACTTTTGGAGCCTGATCGTGGCGACATGGGGAATCGCTCTCAACGCCATTGGCTACCTGCTG
CGCATCTTGCAGTCTGATCACTCAGGCTATGGCCATTCCACCATCATCCTCGTCGGCTGGTGCACCATGGTGACG
GGACAGTCGCTGGTCCTGTATTCACGCCTGCATTTCGTCTTGCACAACACGACGGTGCTGCGTGGCATCCTCATC
TTGATCATCGTAGATGCCATTTGGCTGGGCGTCCCCGTCATCGTCTTCGTTTACGGCTCCAACAGCGACAAGTCC
AAGCTTTTTATCGGGCCGTATGCCATCTTCGAGAGGATCCAGCTGTGCGTCTTCACGGTGCAGGAACTCATCATC
TCCGGCTTCTATATCGTCGAGACATCCAAGACACTGAAGCTCCAGAGGCGTGTGGGTTTAGCGCCTCTCGACGCG
CGCCGTGGCATGGCCCATCTCATCCTGGCCAACATACTCATAGTCCTGCTCGATGTGAGCGTCCTGGTGCTCGAG
TTCAGCGGAAACTACGACATTCAGACGGCGTGGAAGCCGCTGGTGTACAGCATCAAGCTCAAGGTCGAGTTCAGT
GTACTGAACCGGCTCGTCGAGTTTTCACAGCACATGAGGACAGGGAGTCTAGCCAAGATGGGTTCGGACACGGAC
AAGGGCGCCTCTCTCGGCGGCATGACCATGGCCGCCTCCGAGTCGCCGACGGAAGCGCGATACAGCGTCCATGTC
GGCACGTCTCAGAGCCACGAGATCAACGTGAACGACAACGACGAATTCTGCGTTGTCAAGACCACCGACGTCTAC
ATCGATAGCTCAGACAACTCGGCTAGCGGCGGCAGCTCCCGCGACTCTACCGGCCTTGGCACCGAACCAGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail