Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2649
Gene name
Locationscaffold_215:12100..14051
Strand-
Gene length (bp)1951
Transcript length (bp)1500
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05577 Peptidase_S28 Serine carboxypeptidase S28 1.6E-15 71 440

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 46 278 7.0E-10
sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 93 278 1.0E-09
sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 46 278 4.0E-09
sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=1 SV=2 93 278 1.0E-08

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0017171 serine hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2649
MSLARGLYAFLCWFGPGIFGGLLAQFLPEGGKDKPPPPFNLLIPVHSGDRTLGSFSARHAIQKYYDENPRGPLVI
QITMNNPHRELPNSLAADIAQRMNGAAALIEHRGFGETWTHWLNYKGKQAAQNLHERIGNRTARVFPEKMIVVGK
GYSGFLAAALRQRFPHRFDAALAIEAPTRGLSFSWSHADPDQYLYKDAISRLFKRRSEFGAKNIRKSFDLIEDRI
KQGDTKDLQKGLFLCTEPTARNNTAISTLQDLYSEIFVNAAAVGSESANYLSPDTIDSLIAQATKQEITTRQELL
SELGLKHLRHLQRKVSGDLSQLLEIVKSKGKCIDWEKHISRGNEKHATVMTENHYRPLAYIACTYFSLCVLNSRG
DGLFPSRTNACAKLRLSCRDTFEGKAVATPQAEIWKQYKLSPQDLSNSSRIFFSVDTSDPMTALVAADPPSGGGL
CSSSVRREFNIASHQGFTREQALRASRAAQAQKLMEWMGCPQENATGRL
Coding >Ophio5|2649
ATGTCCTTGGCACGGGGCCTCTACGCCTTCCTGTGCTGGTTTGGTCCTGGCATTTTTGGTGGCCTGCTTGCACAG
TTTCTTCCTGAGGGGGGTAAAGACAAACCGCCGCCCCCTTTTAACCTGCTGATTCCGGTCCACTCCGGCGACAGG
ACGCTGGGGTCGTTCTCTGCGCGACATGCCATACAGAAATATTACGATGAGAATCCCCGTGGTCCTCTCGTCATC
CAGATTACCATGAACAACCCTCATCGAGAGCTCCCGAACTCATTAGCCGCCGACATTGCGCAAAGGATGAATGGC
GCAGCAGCACTGATCGAACATCGCGGTTTCGGAGAAACCTGGACACACTGGCTAAACTACAAGGGAAAACAGGCT
GCTCAGAACCTGCATGAACGTATTGGTAATAGGACTGCCCGTGTATTTCCAGAGAAAATGATTGTTGTGGGCAAG
GGCTATTCAGGCTTCCTCGCAGCAGCATTGCGCCAAAGATTTCCACACAGATTTGATGCCGCTCTCGCCATAGAA
GCACCCACTCGCGGGCTTTCATTTAGTTGGAGCCATGCAGATCCTGATCAGTACCTCTATAAAGATGCTATCTCC
CGATTATTCAAGCGTCGTTCAGAGTTTGGGGCGAAAAACATCAGAAAGTCCTTCGATCTAATCGAAGACCGCATT
AAACAAGGGGACACCAAAGACCTTCAAAAGGGTCTTTTTCTATGCACGGAGCCCACTGCTCGTAACAATACGGCG
ATTTCAACGCTTCAAGACCTCTACTCGGAAATCTTTGTGAATGCGGCTGCAGTCGGCAGTGAGAGTGCCAACTAT
TTAAGTCCAGACACCATAGATTCACTTATCGCCCAAGCAACCAAGCAAGAAATCACAACCCGCCAGGAACTCCTC
TCGGAGTTGGGACTCAAGCATCTGCGCCATTTACAAAGAAAAGTCTCGGGGGATCTGTCTCAGTTGCTGGAAATC
GTCAAGTCCAAGGGGAAATGTATCGACTGGGAGAAACACATATCGAGGGGAAATGAGAAGCATGCTACCGTCATG
ACGGAGAACCACTACCGGCCCCTGGCGTATATTGCATGCACCTATTTCTCGCTATGCGTACTCAATTCCCGTGGA
GACGGCTTATTCCCTTCTCGCACCAACGCCTGTGCCAAGTTACGGCTTTCCTGCCGGGATACCTTCGAAGGCAAA
GCTGTTGCAACCCCGCAAGCAGAGATCTGGAAGCAGTATAAATTGAGCCCCCAGGATCTGAGCAATTCGAGCAGA
ATCTTTTTCTCTGTCGATACGTCGGATCCAATGACTGCGCTCGTAGCCGCTGATCCGCCATCGGGGGGTGGTCTT
TGCTCTTCGAGTGTTCGTCGCGAGTTCAACATTGCGTCCCACCAGGGGTTCACGAGGGAACAGGCACTGCGAGCG
TCACGAGCTGCACAAGCGCAAAAGTTGATGGAGTGGATGGGCTGTCCCCAAGAAAATGCAACAGGAAGGTTA
Transcript >Ophio5|2649
ATGTCCTTGGCACGGGGCCTCTACGCCTTCCTGTGCTGGTTTGGTCCTGGCATTTTTGGTGGCCTGCTTGCACAG
TTTCTTCCTGAGGGGGGTAAAGACAAACCGCCGCCCCCTTTTAACCTGCTGATTCCGGTCCACTCCGGCGACAGG
ACGCTGGGGTCGTTCTCTGCGCGACATGCCATACAGAAATATTACGATGAGAATCCCCGTGGTCCTCTCGTCATC
CAGATTACCATGAACAACCCTCATCGAGAGCTCCCGAACTCATTAGCCGCCGACATTGCGCAAAGGATGAATGGC
GCAGCAGCACTGATCGAACATCGCGGTTTCGGAGAAACCTGGACACACTGGCTAAACTACAAGGGAAAACAGGCT
GCTCAGAACCTGCATGAACGTATTGGTAATAGGACTGCCCGTGTATTTCCAGAGAAAATGATTGTTGTGGGCAAG
GGCTATTCAGGCTTCCTCGCAGCAGCATTGCGCCAAAGATTTCCACACAGATTTGATGCCGCTCTCGCCATAGAA
GCACCCACTCGCGGGCTTTCATTTAGTTGGAGCCATGCAGATCCTGATCAGTACCTCTATAAAGATGCTATCTCC
CGATTATTCAAGCGTCGTTCAGAGTTTGGGGCGAAAAACATCAGAAAGTCCTTCGATCTAATCGAAGACCGCATT
AAACAAGGGGACACCAAAGACCTTCAAAAGGGTCTTTTTCTATGCACGGAGCCCACTGCTCGTAACAATACGGCG
ATTTCAACGCTTCAAGACCTCTACTCGGAAATCTTTGTGAATGCGGCTGCAGTCGGCAGTGAGAGTGCCAACTAT
TTAAGTCCAGACACCATAGATTCACTTATCGCCCAAGCAACCAAGCAAGAAATCACAACCCGCCAGGAACTCCTC
TCGGAGTTGGGACTCAAGCATCTGCGCCATTTACAAAGAAAAGTCTCGGGGGATCTGTCTCAGTTGCTGGAAATC
GTCAAGTCCAAGGGGAAATGTATCGACTGGGAGAAACACATATCGAGGGGAAATGAGAAGCATGCTACCGTCATG
ACGGAGAACCACTACCGGCCCCTGGCGTATATTGCATGCACCTATTTCTCGCTATGCGTACTCAATTCCCGTGGA
GACGGCTTATTCCCTTCTCGCACCAACGCCTGTGCCAAGTTACGGCTTTCCTGCCGGGATACCTTCGAAGGCAAA
GCTGTTGCAACCCCGCAAGCAGAGATCTGGAAGCAGTATAAATTGAGCCCCCAGGATCTGAGCAATTCGAGCAGA
ATCTTTTTCTCTGTCGATACGTCGGATCCAATGACTGCGCTCGTAGCCGCTGATCCGCCATCGGGGGGTGGTCTT
TGCTCTTCGAGTGTTCGTCGCGAGTTCAACATTGCGTCCCACCAGGGGTTCACGAGGGAACAGGCACTGCGAGCG
TCACGAGCTGCACAAGCGCAAAAGTTGATGGAGTGGATGGGCTGTCCCCAAGAAAATGCAACAGGAAGGTTATAG
Gene >Ophio5|2649
ATGTCCTTGGCACGGGGCCTCTACGCCTTCCTGTGCTGGTTTGGTCCTGGCATTTTTGGTGGCCTGCTTGCACAG
TTTCTTCCTGAGGGGGGTAAAGACAAACCGCCGCCCCCTTTTAACCTGCTGATTCCGGTCCACTCCGGCGACAGG
ACGCTGGGGTCGTTCTCTGCGCGACATGCCATACAGAAATATTACGATGAGAATCCCCGTGGTCCTCTCGTCATC
CAGATTACCATGAACAACCCTCATCGAGAGCTCGTAAGTTGATTACTTGGCTGCAAATGGGCCAGCCGACCGACT
ACTGACTCGGGGTCGTGCCTTACACAGCCGAACTCATTAGCCGCCGACATTGCGCAAAGGATGAATGGCGCAGCA
GCACTGATCGAACATCGCGGTTTCGGAGAAACCTGGACACACTGGCTAAACTACAAGGGAAAACAGTATGACGAT
CACCTGCGCCTGCTAACGTTAGATACTGTTTTATACGATGCCTTCAGGGCTGCTCAGAACCTGCATGAACGTATT
GGTAATAGGACTGCCCGTGTATTTCCAGAGAAAATGATTGTTGTGGGCAGTAAGTGGATTACCCGTCGATTCCAA
TAAGCTACCAATAGCATGCCTTCTAATCACTCTATTGTAGAGGGCTATTCAGGCTTCCTCGCAGCAGCATTGCGC
CAAAGATTTCCACACAGATTTGATGCCGCTCTCGCCATAGAAGCACCCACTCGCGGGCTTTCATTTAGTTGGAGC
CATGCAGATCCTGATCAGTACCTCTATAAAGATGCTGTCAGTTTACAACTGGTGCGGGCACACAAAGTGCCAAAC
TAATAGTCTCGTTTACCTAGATCTCCCGATTATTCAAGCGTCGTTCAGAGTTTGGGGCGAAAAACATCAGAAAGT
CCTTCGATCTAATCGAAGACCGCATTAAACAAGGTTCGAGCTCCCGTTCCCGCTACCTAATATCCAACTTTGTTA
CTGACTAGTAGCAATTTGTTTAGGGGACACCAAAGACCTTCAAAAGGGTCTTTTTCTATGCACGGAGCCCACTGC
TCGTAACAATACGGCGATTTCAACGCTTCAAGACCTCTACTCGGAAATCTTTGTGAATGCGGCTGCAGTCGGCAG
TGAGAGTGCCAACTATTTAAGTCCAGACACCATAGATTCACTTATCGCCCAAGCAACCAAGCAAGAAATCACAAC
CCGCCAGGAACTCCTCTCGGAGTTGGGACTCAAGCATCTGCGCCATTTACAAAGAAAAGTCTCGGGGGATCTGTC
TCAGTTGCTGGAAATCGTCAAGTCCAAGGGGAAATGTATCGACTGGGAGAAACACATATCGAGGGGAAATGAGAA
GCATGCTACCGTCATGACGGAGAACCACTACCGGCCCCTGGCGTATATTGCATGTGAGTGTCTGGATATCTCATC
ACAATGCTCGACTCACAAGCTAACTCAAGACCTCAGGCACCTATTTCTCGCTATGCGTACTCAATTCCCGTGGAG
ACGGCTTATTCCCTTCTCGCACCAACGCCTGTGCCAAGTTACGGCTTTCCTGCCGGGATACCTTCGAAGGCAAAG
CTGTTGCAACCCCGCAAGCAGAGATCTGGAAGCAGTATAAATTGAGCCCCCAGGATCTGAGCAATTCGAGCAGAA
TCTTTTTCTCTGTCGATACGTCGGATCCAATGACTGCGCTCGTAGCCGCTGATCCGCCATCGGGGGGTGGTCTTT
GCTCTTCGAGTGTTCGTCGCGAGTTCAACATTGCGTCCCACCAGGGGTTCACGAGGGAACAGGCACTGCGAGCGG
TGAGTGCTCCGATATAACCGCCACACGTATTCAAGCATCCCACATCAAAGACTATCTACTGACTGCTCGTCCGCA
GTCACGAGCTGCACAAGCGCAAAAGTTGATGGAGTGGATGGGCTGTCCCCAAGAAAATGCAACAGGAAGGTTATA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail