Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2623
Gene name
Locationscaffold_213:22647..23806
Strand-
Gene length (bp)1159
Transcript length (bp)1113
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 1.6E-54 115 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 107 338 8.0E-21
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 107 338 3.0E-20
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 107 338 4.0E-20
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 107 338 4.0E-20
sp|C7GLH7|RSB1_YEAS2 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RSB1 PE=3 SV=2 107 338 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 107 338 8.0E-21
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 107 338 3.0E-20
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 107 338 4.0E-20
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 107 338 4.0E-20
sp|C7GLH7|RSB1_YEAS2 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RSB1 PE=3 SV=2 107 338 4.0E-20
sp|Q08417|RSB1_YEAST Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSB1 PE=1 SV=3 107 338 4.0E-20
sp|P40113|RTM1_YEASX Protein RTM1 OS=Saccharomyces cerevisiae GN=RTM1 PE=3 SV=1 118 329 3.0E-13
sp|P53047|RTA1_YEAST Protein RTA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTA1 PE=1 SV=1 74 365 3.0E-09
sp|O13780|YEO2_SCHPO Uncharacterized protein C17G6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.02c PE=4 SV=1 84 322 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22
2 109 131 22
3 146 168 22
4 188 210 22
5 225 247 22
6 281 298 17
7 311 333 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2623
MMTTLSLTATSGLLTGPTLTTTSEFIPSATQSIPGNMLIPPAQQPGPLPTTQAEIQKFCEGNPTLTPCSDLPGLY
QYRIDIVPNVLFLALYCISLLWFCTVLARTRRGAFFTLAMVAGLLCEILGYAARIVNWRNQWNVLAFALQFSLIT
LGPTCMAASIYMCLSRIVSAVGIDNSRIPEDYYTKFVGWQFVPCDLVALILQGIGGAVTATSVIGGRSPDTGNRM
LIFGLVLQLLTLAGFIGAALDFSFRAYRRRKRLGPAAFSHHPAFVRLRSTRRFKGVVVALALATLCIFMRSLFHL
AELSEGITGPIFANQGLFIGFEGVLIVIAVYSLNIMNPMQSAPELFPSNSFALWKSEPAPPPVITHKVID
Coding >Ophio5|2623
ATGATGACAACTCTGAGTCTTACCGCAACCTCGGGCCTGCTCACGGGCCCGACCCTCACGACGACGTCCGAATTC
ATACCGAGCGCGACGCAGAGTATACCTGGGAACATGTTGATACCGCCTGCTCAGCAGCCGGGGCCCTTACCCACC
ACGCAAGCGGAGATACAGAAATTCTGCGAGGGCAACCCGACTCTGACGCCGTGCTCCGACCTGCCAGGCTTATAC
CAGTACCGGATCGACATTGTGCCCAACGTCCTCTTTCTCGCTCTATACTGCATCTCACTGCTGTGGTTCTGCACC
GTTCTGGCCCGTACCCGTCGCGGCGCCTTCTTCACCCTGGCCATGGTAGCCGGTTTGCTCTGCGAGATATTGGGC
TACGCCGCCCGCATCGTCAACTGGCGCAATCAGTGGAACGTTTTGGCCTTTGCGCTTCAGTTCTCTCTCATTACC
CTGGGTCCGACCTGTATGGCTGCCAGCATCTACATGTGTCTAAGCCGGATCGTCTCGGCCGTCGGCATCGACAAC
TCGCGCATCCCAGAGGATTACTACACTAAATTCGTCGGCTGGCAGTTCGTTCCCTGTGACCTAGTCGCCCTTATT
CTTCAAGGCATCGGCGGCGCTGTCACGGCGACATCCGTCATCGGGGGCCGTTCGCCTGATACGGGCAATAGGATG
CTCATCTTCGGCCTCGTCTTACAGCTGCTGACTCTCGCCGGCTTCATCGGGGCTGCGCTCGACTTCTCCTTCCGT
GCTTACCGTCGCAGGAAAAGACTCGGTCCGGCAGCCTTCTCCCATCACCCGGCCTTTGTGCGCCTACGGTCTACA
CGGCGCTTCAAGGGCGTCGTCGTGGCTCTCGCCCTCGCGACGCTATGCATCTTCATGCGCAGCCTCTTTCACCTC
GCCGAGCTCAGCGAGGGCATCACGGGGCCCATCTTTGCCAATCAGGGTCTCTTCATCGGCTTCGAGGGCGTTCTC
ATCGTCATCGCTGTTTACTCGCTTAATATCATGAACCCGATGCAAAGCGCACCCGAGCTCTTCCCTAGTAACAGC
TTCGCTCTGTGGAAGTCAGAGCCAGCACCGCCGCCTGTCATTACTCACAAAGTCATCGAC
Transcript >Ophio5|2623
ATGATGACAACTCTGAGTCTTACCGCAACCTCGGGCCTGCTCACGGGCCCGACCCTCACGACGACGTCCGAATTC
ATACCGAGCGCGACGCAGAGTATACCTGGGAACATGTTGATACCGCCTGCTCAGCAGCCGGGGCCCTTACCCACC
ACGCAAGCGGAGATACAGAAATTCTGCGAGGGCAACCCGACTCTGACGCCGTGCTCCGACCTGCCAGGCTTATAC
CAGTACCGGATCGACATTGTGCCCAACGTCCTCTTTCTCGCTCTATACTGCATCTCACTGCTGTGGTTCTGCACC
GTTCTGGCCCGTACCCGTCGCGGCGCCTTCTTCACCCTGGCCATGGTAGCCGGTTTGCTCTGCGAGATATTGGGC
TACGCCGCCCGCATCGTCAACTGGCGCAATCAGTGGAACGTTTTGGCCTTTGCGCTTCAGTTCTCTCTCATTACC
CTGGGTCCGACCTGTATGGCTGCCAGCATCTACATGTGTCTAAGCCGGATCGTCTCGGCCGTCGGCATCGACAAC
TCGCGCATCCCAGAGGATTACTACACTAAATTCGTCGGCTGGCAGTTCGTTCCCTGTGACCTAGTCGCCCTTATT
CTTCAAGGCATCGGCGGCGCTGTCACGGCGACATCCGTCATCGGGGGCCGTTCGCCTGATACGGGCAATAGGATG
CTCATCTTCGGCCTCGTCTTACAGCTGCTGACTCTCGCCGGCTTCATCGGGGCTGCGCTCGACTTCTCCTTCCGT
GCTTACCGTCGCAGGAAAAGACTCGGTCCGGCAGCCTTCTCCCATCACCCGGCCTTTGTGCGCCTACGGTCTACA
CGGCGCTTCAAGGGCGTCGTCGTGGCTCTCGCCCTCGCGACGCTATGCATCTTCATGCGCAGCCTCTTTCACCTC
GCCGAGCTCAGCGAGGGCATCACGGGGCCCATCTTTGCCAATCAGGGTCTCTTCATCGGCTTCGAGGGCGTTCTC
ATCGTCATCGCTGTTTACTCGCTTAATATCATGAACCCGATGCAAAGCGCACCCGAGCTCTTCCCTAGTAACAGC
TTCGCTCTGTGGAAGTCAGAGCCAGCACCGCCGCCTGTCATTACTCACAAAGTCATCGACTGA
Gene >Ophio5|2623
ATGATGACAACTCTGAGTCTTACCGCAACCTCGGGCCTGCTCACGGGCCCGACCCTCACGACGACGTCCGAATTC
ATACCGAGCGCGACGCAGAGTATACCTGGGAACATGTTGATACCGCCTGCTCAGCAGCCGGGGCCCTTACCCACC
ACGCAAGCGGAGATACAGAAATTCTGCGAGGGCAACCCGACTCTGACGCCGTGCTCCGACCTGCCAGGCTTATAC
CAGTACCGGATCGACATTGTGCCCAACGTCCTCTTTCTCGCTCTATACTGCATCTCACTGCTGTGGTTCTGCACC
GTTCTGGCCCGTACCCGTCGCGGCGCCTTCTTCACCCTGGCCATGGTAGCCGGTTTGCTCTGCGAGATATTGGGC
TACGCCGCCCGCATCGTCAACTGGCGCAATCAGTGGAACGTTTTGGCCTTTGCGCTTCAGTTCTCTCTCATTACC
CTGGGTCCGACCTGTATGGCTGCCAGCATCTACATGTGTCTAAGCCGGATCGTCTCGGCCGTCGGCATCGACAAC
TCGCGCATCCCAGAGGATTACTACACTAAATTCGTCCGTTTTTTTCTCTCATCACCTGTTTCATCAAATTCGCTG
ACAGGTCGGCTGGCAGTTCGTTCCCTGTGACCTAGTCGCCCTTATTCTTCAAGGCATCGGCGGCGCTGTCACGGC
GACATCCGTCATCGGGGGCCGTTCGCCTGATACGGGCAATAGGATGCTCATCTTCGGCCTCGTCTTACAGCTGCT
GACTCTCGCCGGCTTCATCGGGGCTGCGCTCGACTTCTCCTTCCGTGCTTACCGTCGCAGGAAAAGACTCGGTCC
GGCAGCCTTCTCCCATCACCCGGCCTTTGTGCGCCTACGGTCTACACGGCGCTTCAAGGGCGTCGTCGTGGCTCT
CGCCCTCGCGACGCTATGCATCTTCATGCGCAGCCTCTTTCACCTCGCCGAGCTCAGCGAGGGCATCACGGGGCC
CATCTTTGCCAATCAGGGTCTCTTCATCGGCTTCGAGGGCGTTCTCATCGTCATCGCTGTTTACTCGCTTAATAT
CATGAACCCGATGCAAAGCGCACCCGAGCTCTTCCCTAGTAACAGCTTCGCTCTGTGGAAGTCAGAGCCAGCACC
GCCGCCTGTCATTACTCACAAAGTCATCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail