Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2622
Gene name
Locationscaffold_213:20305..21827
Strand-
Gene length (bp)1522
Transcript length (bp)1341
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13127 DUF3955 Protein of unknown function (DUF3955) 7.5E-08 61 114
PF06027 SLC35F Solute carrier family 35 2.2E-05 196 325

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 58 435 7.0E-78
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 58 430 4.0E-56
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 55 421 5.0E-47
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 55 424 3.0E-46
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 55 424 9.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 58 435 7.0E-78
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 58 430 4.0E-56
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 55 421 5.0E-47
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 55 424 3.0E-46
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 55 424 9.0E-46
sp|Q8R314|S35F5_MOUSE Solute carrier family 35 member F5 OS=Mus musculus GN=Slc35f5 PE=2 SV=1 58 425 3.0E-45
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 109 424 2.0E-42
sp|Q04083|THI74_YEAST Thiamine-repressible mitochondrial transport protein THI74 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI74 PE=1 SV=1 72 443 3.0E-38
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 94 116 22
3 189 211 22
4 215 237 22
5 244 263 19
6 278 300 22
7 317 339 22
8 371 393 22
9 405 424 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2622
MASPERPDHRMSRRLSDATAADAAAALAPVSRSLSPVVASAAIKEEDGRLLAGLGLTRRALGICLLLVTVFLWTT
SNFLASFIFSDHTYDKPFFLVYINSSVFAFSLAPMATRYLFEKGLRGLRRDALRLWRERRLPKTISKTAVAAEEE
ETEEETAGERLLMSDEEAAEGLEEQSAGTDKLGMRETAVLSFEFSMLWFAANYLASACLGFTSVASVTILTSTSS
MWTLVLCAVYRVEHFSVRKLVGVTASLVGVALVSTVDLSGSSDENRGSFPHKTPGQIAAGDAMALLSAVVYGLYV
TVMKRRVGREDRVDMRLFFGLVGVFNLVLLWPLFPVLHWTGIEPFAMPPTAKVWAVIAANSLSSFISDMSWAFAM
LLTTPLVVTVGLSLTIPLSLIGEMVQYGQYSSFVYWIGAGIVLLSFVFINSESQEEEGEEEKEEEEEARGG
Coding >Ophio5|2622
ATGGCGTCGCCGGAGAGGCCGGACCACCGGATGTCGAGGCGGCTCAGTGACGCCACTGCTGCTGACGCCGCTGCC
GCCCTCGCGCCGGTCAGCCGGAGCTTGTCGCCGGTGGTGGCCTCGGCGGCGATCAAGGAGGAGGACGGTCGATTG
CTTGCCGGCTTGGGCCTTACCAGACGAGCGCTCGGAATTTGCCTCTTGCTCGTCACCGTCTTTCTGTGGACCACG
TCCAACTTTCTGGCCAGCTTCATCTTCTCAGACCACACTTACGACAAGCCCTTCTTTCTCGTCTACATCAACTCA
TCCGTCTTTGCCTTTTCGCTGGCACCGATGGCGACGCGGTATCTATTTGAAAAGGGGTTGCGCGGGCTGCGACGT
GACGCGCTGCGGCTATGGCGAGAGCGTCGGCTGCCGAAGACGATATCCAAGACGGCAGTGGCGGCGGAAGAGGAG
GAGACGGAGGAGGAGACGGCGGGCGAGCGGCTCCTGATGTCGGACGAAGAGGCCGCTGAAGGATTAGAGGAGCAG
TCGGCAGGCACGGACAAACTCGGGATGCGCGAGACGGCCGTGTTAAGCTTTGAGTTCTCGATGCTTTGGTTCGCG
GCCAACTACCTGGCCTCTGCGTGCCTCGGCTTCACGAGCGTGGCAAGCGTGACGATCCTGACGTCTACCAGCAGC
ATGTGGACGCTGGTTCTTTGCGCCGTCTACCGCGTCGAGCACTTCTCGGTGCGCAAGCTGGTGGGCGTGACGGCC
TCGCTGGTGGGCGTCGCTCTCGTCTCGACGGTAGACCTGTCCGGCTCGAGCGATGAGAACCGCGGCTCGTTCCCG
CACAAGACACCGGGCCAGATCGCGGCGGGCGATGCCATGGCGTTACTGAGCGCCGTCGTCTACGGGCTGTACGTG
ACGGTGATGAAGCGAAGGGTAGGGCGCGAGGACCGGGTCGACATGCGACTGTTCTTTGGTCTGGTTGGCGTTTTC
AACCTGGTCTTGCTATGGCCGCTCTTTCCGGTACTACACTGGACGGGAATCGAACCGTTTGCGATGCCGCCGACG
GCCAAAGTGTGGGCGGTCATTGCGGCCAATTCGCTGTCGTCGTTTATCAGCGACATGAGCTGGGCGTTTGCGATG
CTGCTGACGACGCCGCTGGTGGTGACGGTGGGCCTGTCATTGACGATTCCGCTGTCACTGATCGGGGAGATGGTG
CAGTACGGGCAGTATTCGAGCTTCGTCTATTGGATCGGGGCGGGCATTGTGCTTTTGTCGTTTGTCTTTATCAAC
AGCGAGAGTCAGGAGGAGGAGGGGGAGGAGGAGAAGGAGGAAGAGGAGGAAGCGAGGGGTGGT
Transcript >Ophio5|2622
ATGGCGTCGCCGGAGAGGCCGGACCACCGGATGTCGAGGCGGCTCAGTGACGCCACTGCTGCTGACGCCGCTGCC
GCCCTCGCGCCGGTCAGCCGGAGCTTGTCGCCGGTGGTGGCCTCGGCGGCGATCAAGGAGGAGGACGGTCGATTG
CTTGCCGGCTTGGGCCTTACCAGACGAGCGCTCGGAATTTGCCTCTTGCTCGTCACCGTCTTTCTGTGGACCACG
TCCAACTTTCTGGCCAGCTTCATCTTCTCAGACCACACTTACGACAAGCCCTTCTTTCTCGTCTACATCAACTCA
TCCGTCTTTGCCTTTTCGCTGGCACCGATGGCGACGCGGTATCTATTTGAAAAGGGGTTGCGCGGGCTGCGACGT
GACGCGCTGCGGCTATGGCGAGAGCGTCGGCTGCCGAAGACGATATCCAAGACGGCAGTGGCGGCGGAAGAGGAG
GAGACGGAGGAGGAGACGGCGGGCGAGCGGCTCCTGATGTCGGACGAAGAGGCCGCTGAAGGATTAGAGGAGCAG
TCGGCAGGCACGGACAAACTCGGGATGCGCGAGACGGCCGTGTTAAGCTTTGAGTTCTCGATGCTTTGGTTCGCG
GCCAACTACCTGGCCTCTGCGTGCCTCGGCTTCACGAGCGTGGCAAGCGTGACGATCCTGACGTCTACCAGCAGC
ATGTGGACGCTGGTTCTTTGCGCCGTCTACCGCGTCGAGCACTTCTCGGTGCGCAAGCTGGTGGGCGTGACGGCC
TCGCTGGTGGGCGTCGCTCTCGTCTCGACGGTAGACCTGTCCGGCTCGAGCGATGAGAACCGCGGCTCGTTCCCG
CACAAGACACCGGGCCAGATCGCGGCGGGCGATGCCATGGCGTTACTGAGCGCCGTCGTCTACGGGCTGTACGTG
ACGGTGATGAAGCGAAGGGTAGGGCGCGAGGACCGGGTCGACATGCGACTGTTCTTTGGTCTGGTTGGCGTTTTC
AACCTGGTCTTGCTATGGCCGCTCTTTCCGGTACTACACTGGACGGGAATCGAACCGTTTGCGATGCCGCCGACG
GCCAAAGTGTGGGCGGTCATTGCGGCCAATTCGCTGTCGTCGTTTATCAGCGACATGAGCTGGGCGTTTGCGATG
CTGCTGACGACGCCGCTGGTGGTGACGGTGGGCCTGTCATTGACGATTCCGCTGTCACTGATCGGGGAGATGGTG
CAGTACGGGCAGTATTCGAGCTTCGTCTATTGGATCGGGGCGGGCATTGTGCTTTTGTCGTTTGTCTTTATCAAC
AGCGAGAGTCAGGAGGAGGAGGGGGAGGAGGAGAAGGAGGAAGAGGAGGAAGCGAGGGGTGGTTAG
Gene >Ophio5|2622
ATGGCGTCGCCGGAGAGGCCGGACCACCGGATGTCGAGGCGGCTCAGTGACGCCACTGCTGCTGACGCCGCTGCC
GCCCTCGCGCCGGTCAGCCGGAGCTTGTCGCCGGTGGTGGCCTCGGCGGCGATCAAGGAGGAGGACGGTCGATTG
CTTGCCGGCTTGGGCCTTACCAGACGAGCGCTCGGAATTTGCCTCTTGCTCGTCACCGTCTTTCTGTGGACCACG
TCCAACTTTCTGGCCAGCGTACGTCTTTTTTTCGCCCTCTCTGTCTCTGCCCCTTCCTGGCCTAGGGCGCTGACT
TGGGGTGTCCGTCACAGTTCATCTTCTCAGACCACACTTACGACAAGCCCTTCTTTCTCGTCTACATCAACTCAT
CCGTCTTTGCCTTTTCGCTGGCACCGATGGCGACGCGGTATCTATTTGAAAAGGGGTTGCGCGGGCTGCGACGTG
ACGCGCTGCGGCTATGGCGAGAGCGTCGGCTGCCGAAGACGATATCCAAGACGGCAGTGGCGGCGGAAGAGGAGG
AGACGGAGGAGGAGACGGCGGGCGAGCGGCTCCTGATGTCGGACGAAGAGGCCGCTGAAGGATTAGAGGAGCAGT
CGGCAGGCACGGACAAACTCGGGATGCGCGAGACGGCCGTGTTAAGCTTTGAGTTCTCGATGCTTTGGTTCGCGG
CCAACTACCTGGCCTCTGCGTGCCTCGGCTTCACGAGCGTGGCAAGCGTGACGATCCTGACGTCTACCAGCAGCA
TGTGGACGCTGGTTCTTTGCGCCGTCTACCGCGTCGAGCACTTCTCGGTGCGCAAGCTGGTGGGCGTGACGGCCT
CGCTGGTGGGCGTCGCTCTCGTCTCGACGGTAGACCTGTCCGGCTCGAGCGATGAGAACCGCGGCTCGTTCCCGC
ACAAGACACCGGGCCAGATCGCGGCGGGCGATGCCATGGCGTTACTGAGCGCCGTCGTCTACGGGCTGTACGTGA
CGGTGATGAAGCGAAGGGTAGGGCGCGAGGACCGGGTCGACATGCGACTGTTCTTTGGTCTGGTTGGCGTTTTCA
ACCTGGTCTTGCTATGGCCGCTCTTTCCGGTACTACACTGGACGGGAATCGAACCGGTATGTGAGACAGGAAGAG
ACAGGTTGGAAGAGGGTCTGACTGGGTGTTGCAGTTTGCGATGCCGCCGACGGCCAAAGTGTGGGCGGTCATTGC
GGCAAGTCTCAGCCTACCCTTCCTCGTCTGACGTCTGGATGCTGACGAGAGACAGGCCAATTCGCTGTCGTCGTT
TATCAGCGACATGAGCTGGGCGTTTGCGATGCTGCTGACGACGCCGCTGGTGGTGACGGTGGGCCTGTCATTGAC
GATTCCGCTGTCACTGATCGGGGAGATGGTGCAGTACGGGCAGTATTCGAGCTTCGTCTATTGGATCGGGGCGGG
CATTGTGCTTTTGTCGTTTGTCTTTATCAACAGCGAGAGTCAGGAGGAGGAGGGGGAGGAGGAGAAGGAGGAAGA
GGAGGAAGCGAGGGGTGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail