Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2621
Gene name
Locationscaffold_213:18147..19482
Strand-
Gene length (bp)1335
Transcript length (bp)1335
Coding sequence length (bp)1332
Protein length (aa) 444

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32339|HMX1_YEAST Heme-binding protein HMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMX1 PE=2 SV=3 16 181 1.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.2323 0.2515 0.1801 0.1312 0.4409 0.0192 0.7516 0.4106 0.514 0.2204

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 417 439 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 17.59 7.61 27.56
CcL In ants, during behavior modification 18.80 7.96 29.63
CcD In ants, recently dead 14.86 6.07 23.64

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.844423 no
SC16a CcD 0.605833 no
CcL CcD 0.450389 no

Orthologs

Orthofinder run ID4
Orthogroup5918
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2281
Ophiocordyceps australis map64 (Brazil) OphauB2|5991
Ophiocordyceps camponoti-rufipedis Ophun1|5910
Ophiocordyceps kimflemingae Ophio5|2621 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2621
MSNPDLDALLQQGWPLTQSLNMATRHVHTRINKLIMSRLSMALPPRAEDATLYLMGLIHVTAMYEAVESSWQQVC
DGEEEEEERCTRTVMRPAVGHLLQRLRLPGLMRTRRLRHDVFALSGWSDELVEERISDLVLGTQLVADFVDRLKG
LVSLKPHVLVAYAHVLFMALFAGGKYIGARIEAAGVEFWESFRRGGGGGGGGHGAFHHHHHHHHHHHHHHHLLLH
RHLPHLPPSNQPHPPDALPLRFFRFDTPQQGQDLKHEFKLILAESESLLTQTEKYDILQEAIYLFEYVGHLVSHL
DTVCGALQPPLRRRSSAPSISSSSSSPSSPSLVSGFLAHGLGSRMRDSIAVTRQRWDHDYRQRGSPPPSDHASSL
CPVAVASPLKPSDVDEDRVAASVKVVRFDKSSSAVDAARSPHVLLLMAAVLLFAAVVLSRWSLGTWLHD
Coding >Ophio5|2621
ATGTCGAATCCCGACCTCGACGCCCTACTACAACAAGGCTGGCCACTGACGCAAAGCCTCAACATGGCGACGCGG
CACGTGCACACGCGAATCAACAAGCTGATCATGTCGCGACTTTCGATGGCGCTTCCACCACGGGCGGAGGATGCG
ACTCTGTACCTGATGGGACTGATACACGTCACGGCCATGTACGAAGCGGTGGAATCGTCATGGCAGCAAGTCTGC
GACGGCGAAGAAGAAGAAGAAGAAAGGTGCACAAGGACGGTGATGCGACCTGCTGTTGGTCATCTTCTCCAGCGA
TTGCGTCTTCCTGGCTTGATGCGTACCCGTCGCTTGCGTCATGATGTGTTTGCCCTCTCGGGCTGGAGTGACGAG
TTGGTGGAGGAGAGGATTTCGGATCTGGTCTTGGGTACGCAACTGGTGGCTGACTTTGTCGACAGGTTGAAGGGA
CTGGTTAGCTTGAAGCCTCATGTTTTGGTCGCCTATGCTCATGTCCTCTTCATGGCGCTCTTTGCTGGCGGCAAG
TATATCGGTGCCAGGATTGAGGCGGCCGGGGTGGAGTTTTGGGAGTCGTTTCGCAGGGGAGGAGGAGGAGGAGGA
GGAGGACATGGTGCTTTCCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCTGCTTCTTCAC
CGGCATCTTCCTCATCTCCCTCCGTCGAACCAACCACACCCCCCAGACGCCCTCCCGCTACGCTTCTTCCGCTTC
GACACCCCCCAACAAGGCCAAGACCTCAAACACGAATTCAAGCTCATCCTCGCCGAGTCCGAATCGCTGCTGACC
CAGACGGAAAAGTACGACATCCTCCAGGAAGCCATCTACCTATTCGAATACGTCGGCCACCTCGTCAGCCACCTC
GACACCGTCTGCGGAGCCCTACAACCGCCACTCCGTCGACGCTCATCCGCTCCTTCAATCTCTTCTTCTTCTTCT
TCTCCTTCTTCGCCTTCCCTCGTGTCCGGCTTCTTGGCCCATGGTCTTGGTTCGAGGATGCGTGATAGCATTGCT
GTTACGCGTCAGCGTTGGGATCATGATTATCGTCAAAGGGGCTCGCCACCACCATCGGATCATGCTTCTTCGCTT
TGCCCTGTTGCCGTTGCCTCTCCTCTCAAGCCGTCTGACGTGGACGAGGACCGTGTTGCTGCTTCCGTCAAGGTG
GTGCGCTTTGACAAGTCTTCGTCGGCCGTCGATGCTGCTCGCTCACCCCATGTCTTACTCCTCATGGCTGCTGTT
TTGCTCTTTGCTGCTGTCGTGCTTTCGCGCTGGAGTCTTGGCACTTGGTTGCATGAT
Transcript >Ophio5|2621
ATGTCGAATCCCGACCTCGACGCCCTACTACAACAAGGCTGGCCACTGACGCAAAGCCTCAACATGGCGACGCGG
CACGTGCACACGCGAATCAACAAGCTGATCATGTCGCGACTTTCGATGGCGCTTCCACCACGGGCGGAGGATGCG
ACTCTGTACCTGATGGGACTGATACACGTCACGGCCATGTACGAAGCGGTGGAATCGTCATGGCAGCAAGTCTGC
GACGGCGAAGAAGAAGAAGAAGAAAGGTGCACAAGGACGGTGATGCGACCTGCTGTTGGTCATCTTCTCCAGCGA
TTGCGTCTTCCTGGCTTGATGCGTACCCGTCGCTTGCGTCATGATGTGTTTGCCCTCTCGGGCTGGAGTGACGAG
TTGGTGGAGGAGAGGATTTCGGATCTGGTCTTGGGTACGCAACTGGTGGCTGACTTTGTCGACAGGTTGAAGGGA
CTGGTTAGCTTGAAGCCTCATGTTTTGGTCGCCTATGCTCATGTCCTCTTCATGGCGCTCTTTGCTGGCGGCAAG
TATATCGGTGCCAGGATTGAGGCGGCCGGGGTGGAGTTTTGGGAGTCGTTTCGCAGGGGAGGAGGAGGAGGAGGA
GGAGGACATGGTGCTTTCCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCTGCTTCTTCAC
CGGCATCTTCCTCATCTCCCTCCGTCGAACCAACCACACCCCCCAGACGCCCTCCCGCTACGCTTCTTCCGCTTC
GACACCCCCCAACAAGGCCAAGACCTCAAACACGAATTCAAGCTCATCCTCGCCGAGTCCGAATCGCTGCTGACC
CAGACGGAAAAGTACGACATCCTCCAGGAAGCCATCTACCTATTCGAATACGTCGGCCACCTCGTCAGCCACCTC
GACACCGTCTGCGGAGCCCTACAACCGCCACTCCGTCGACGCTCATCCGCTCCTTCAATCTCTTCTTCTTCTTCT
TCTCCTTCTTCGCCTTCCCTCGTGTCCGGCTTCTTGGCCCATGGTCTTGGTTCGAGGATGCGTGATAGCATTGCT
GTTACGCGTCAGCGTTGGGATCATGATTATCGTCAAAGGGGCTCGCCACCACCATCGGATCATGCTTCTTCGCTT
TGCCCTGTTGCCGTTGCCTCTCCTCTCAAGCCGTCTGACGTGGACGAGGACCGTGTTGCTGCTTCCGTCAAGGTG
GTGCGCTTTGACAAGTCTTCGTCGGCCGTCGATGCTGCTCGCTCACCCCATGTCTTACTCCTCATGGCTGCTGTT
TTGCTCTTTGCTGCTGTCGTGCTTTCGCGCTGGAGTCTTGGCACTTGGTTGCATGATTGA
Gene >Ophio5|2621
ATGTCGAATCCCGACCTCGACGCCCTACTACAACAAGGCTGGCCACTGACGCAAAGCCTCAACATGGCGACGCGG
CACGTGCACACGCGAATCAACAAGCTGATCATGTCGCGACTTTCGATGGCGCTTCCACCACGGGCGGAGGATGCG
ACTCTGTACCTGATGGGACTGATACACGTCACGGCCATGTACGAAGCGGTGGAATCGTCATGGCAGCAAGTCTGC
GACGGCGAAGAAGAAGAAGAAGAAAGGTGCACAAGGACGGTGATGCGACCTGCTGTTGGTCATCTTCTCCAGCGA
TTGCGTCTTCCTGGCTTGATGCGTACCCGTCGCTTGCGTCATGATGTGTTTGCCCTCTCGGGCTGGAGTGACGAG
TTGGTGGAGGAGAGGATTTCGGATCTGGTCTTGGGTACGCAACTGGTGGCTGACTTTGTCGACAGGTTGAAGGGA
CTGGTTAGCTTGAAGCCTCATGTTTTGGTCGCCTATGCTCATGTCCTCTTCATGGCGCTCTTTGCTGGCGGCAAG
TATATCGGTGCCAGGATTGAGGCGGCCGGGGTGGAGTTTTGGGAGTCGTTTCGCAGGGGAGGAGGAGGAGGAGGA
GGAGGACATGGTGCTTTCCATCATCATCATCATCATCATCATCATCATCATCATCATCATCATCTGCTTCTTCAC
CGGCATCTTCCTCATCTCCCTCCGTCGAACCAACCACACCCCCCAGACGCCCTCCCGCTACGCTTCTTCCGCTTC
GACACCCCCCAACAAGGCCAAGACCTCAAACACGAATTCAAGCTCATCCTCGCCGAGTCCGAATCGCTGCTGACC
CAGACGGAAAAGTACGACATCCTCCAGGAAGCCATCTACCTATTCGAATACGTCGGCCACCTCGTCAGCCACCTC
GACACCGTCTGCGGAGCCCTACAACCGCCACTCCGTCGACGCTCATCCGCTCCTTCAATCTCTTCTTCTTCTTCT
TCTCCTTCTTCGCCTTCCCTCGTGTCCGGCTTCTTGGCCCATGGTCTTGGTTCGAGGATGCGTGATAGCATTGCT
GTTACGCGTCAGCGTTGGGATCATGATTATCGTCAAAGGGGCTCGCCACCACCATCGGATCATGCTTCTTCGCTT
TGCCCTGTTGCCGTTGCCTCTCCTCTCAAGCCGTCTGACGTGGACGAGGACCGTGTTGCTGCTTCCGTCAAGGTG
GTGCGCTTTGACAAGTCTTCGTCGGCCGTCGATGCTGCTCGCTCACCCCATGTCTTACTCCTCATGGCTGCTGTT
TTGCTCTTTGCTGCTGTCGTGCTTTCGCGCTGGAGTCTTGGCACTTGGTTGCATGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail