Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2620
Gene name
Locationscaffold_213:15443..17791
Strand+
Gene length (bp)2348
Transcript length (bp)2208
Coding sequence length (bp)2205
Protein length (aa) 735

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 6.3E-02 449 487
PF00400 WD40 WD domain, G-beta repeat 1.3E-02 669 698

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 243 699 6.0E-32
sp|Q6GPU3|DTLB_XENLA Denticleless protein homolog B OS=Xenopus laevis GN=dtl-b PE=2 SV=1 303 701 4.0E-19
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 303 724 4.0E-19
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 292 723 2.0E-18
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 303 699 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 243 699 6.0E-32
sp|Q6GPU3|DTLB_XENLA Denticleless protein homolog B OS=Xenopus laevis GN=dtl-b PE=2 SV=1 303 701 4.0E-19
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 303 724 4.0E-19
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 292 723 2.0E-18
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 303 699 4.0E-18
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 276 723 4.0E-18
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 303 724 1.0E-17
sp|Q9NZJ0|DTL_HUMAN Denticleless protein homolog OS=Homo sapiens GN=DTL PE=1 SV=3 303 724 3.0E-16
sp|Q24371|L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster GN=l(2)dtl PE=1 SV=2 240 699 9.0E-13
sp|Q9C1X0|YN55_SCHPO Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1 333 454 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2417 0.95 0.026 0.0115 0.0282 0.0061 0.0181 0.0112 0.005 0.0097

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1571
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2280
Ophiocordyceps australis map64 (Brazil) OphauB2|5992
Ophiocordyceps camponoti-floridani Ophcf2|06778
Ophiocordyceps camponoti-rufipedis Ophun1|5909
Ophiocordyceps kimflemingae Ophio5|2620 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1164

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2620
METHHYSDEEMPSSPPAAASTQHAHGFLSPTRSPMSFSTRSPLRLPSRSPPRSPPRSPSRSTRMKEKRVPSVTPR
RLRTFFTPRTHLSTISRMTLGTLDSASVNRLASRPLSPPPSSDPIEPPSSPTERLQAVENANRKKRSVPQSGSRT
KRRRTVLSDEEPQSTVADEKKFVSVNGVNERRTLSQFFKASRRGVMGSGGKSLQCSPPILAAQADSSTSLRGYRP
QPIRKLRNRGFEASLLDREHGFSTHTGKQYLAFPTSDPRIETANFYSDSSDAYHCTPLGNQPGTSIPFSLASCHR
ASLTAIGDERGHVRYFSTAGDASQMVTSWVKVHDNAIMDLDFSADDTRLASACGDRTGRVLDTQTQSVAVELGEH
WDSLRQVTFQPGSGNGNVLASSDRAGRVQVWDLRCSSLPAQCFSSAADGVGRDRRLDIVAARTVNTIDSAHERTM
QGSTSSSSVTALQWLPAGREHLLLTGSEANGSVKLWDTRYIKARRQRQAAETPIAVTPEPATHAWRSYGITSMTL
GTDAARLYVVCKDSTVYAYSTNHLVLGHAPELLDGASKRKPLGSQGLGPLYGLKNDKLRVGSFYVKCAVRPGGGG
GADELLAVGSSDGCAVVFPTNERYMRAAWARREHIPAGGTTSMAPPPTPSNPWASTTLPLVRAGTPLVRGHSLEV
TTLSWSWDGKLVTASDDCFVRRWQRNAARAGYLRQVGEFGGERHLAGWAEVGDDWDVDEC
Coding >Ophio5|2620
ATGGAGACACACCATTACTCAGACGAGGAGATGCCATCGAGCCCGCCTGCGGCTGCGTCAACCCAGCACGCCCAT
GGGTTTCTCTCCCCGACGAGGTCGCCCATGAGCTTCTCGACGAGATCGCCGTTGAGACTCCCGTCCAGATCCCCT
CCCAGATCCCCTCCGAGATCCCCGTCACGATCGACACGGATGAAGGAGAAGCGTGTTCCCTCGGTTACGCCGAGA
CGGCTTCGGACCTTCTTCACCCCCCGTACCCATCTATCTACGATCAGTCGAATGACGCTGGGGACTCTGGATTCC
GCTTCCGTCAACCGCCTGGCTTCTAGGCCGCTGTCTCCTCCTCCGAGTTCGGACCCGATCGAACCGCCCTCCTCG
CCGACAGAACGGCTTCAGGCCGTCGAGAACGCCAATAGGAAGAAACGTTCGGTGCCGCAGTCAGGGTCGCGGACG
AAGCGACGGCGAACTGTTCTGTCCGACGAAGAGCCCCAGTCGACAGTTGCCGACGAGAAAAAATTCGTGTCTGTC
AACGGCGTCAACGAGAGGCGCACTCTTAGCCAGTTCTTCAAAGCTAGTCGCAGAGGGGTCATGGGCTCGGGTGGA
AAGTCTCTCCAATGCAGTCCACCAATCCTCGCCGCACAGGCCGACTCATCCACGTCGCTCCGAGGATACCGACCG
CAGCCGATTCGAAAGCTGCGTAACCGCGGTTTCGAAGCCAGCCTACTCGACCGCGAGCATGGCTTCAGCACCCAT
ACCGGCAAACAATATCTGGCCTTTCCCACTTCCGATCCCAGAATAGAGACGGCCAATTTCTACAGCGACAGCTCC
GACGCCTACCACTGCACCCCCCTGGGCAATCAGCCCGGCACATCCATCCCCTTTAGCCTCGCGAGCTGCCACCGT
GCCTCGCTAACGGCCATCGGCGACGAACGAGGCCATGTGCGCTACTTTTCCACGGCCGGGGACGCCAGCCAGATG
GTGACGAGCTGGGTCAAGGTGCACGACAACGCCATCATGGATCTTGACTTCTCCGCCGACGACACTCGTCTGGCG
AGCGCATGTGGCGACAGGACGGGCCGTGTGCTTGATACTCAGACTCAATCCGTCGCCGTCGAGCTAGGTGAGCAC
TGGGACTCGCTCCGACAGGTCACCTTTCAGCCCGGCAGCGGCAACGGGAACGTGCTCGCCTCGTCGGACCGCGCG
GGCCGTGTCCAAGTCTGGGACCTCCGATGCTCCTCTCTGCCGGCCCAATGCTTCTCGTCGGCTGCGGACGGTGTT
GGTCGAGATCGGAGACTGGACATTGTGGCGGCCCGGACGGTCAACACCATCGACAGCGCGCACGAGCGTACCATG
CAGGGGAGCACGTCGTCTTCCTCAGTCACGGCCCTGCAGTGGCTGCCGGCCGGCCGCGAACACCTCCTGCTGACG
GGCTCGGAAGCCAACGGGTCCGTCAAGCTATGGGACACACGCTACATCAAAGCGCGGCGACAAAGACAAGCGGCG
GAGACGCCGATAGCAGTGACACCCGAGCCGGCGACACACGCGTGGCGCTCCTACGGCATCACGTCCATGACGCTC
GGCACCGACGCCGCACGGCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTACTCGACCAACCACCTCGTC
CTCGGCCACGCGCCCGAGTTGCTGGACGGAGCGAGCAAGCGCAAGCCCCTCGGCTCCCAAGGCCTCGGGCCGCTC
TACGGCCTCAAGAACGACAAGCTCCGCGTCGGCTCTTTCTACGTCAAGTGCGCCGTTCGTCCTGGCGGCGGCGGC
GGCGCGGACGAGCTCCTCGCCGTGGGCAGCTCCGACGGCTGTGCCGTTGTCTTCCCTACCAACGAACGCTACATG
CGGGCCGCGTGGGCTCGTCGCGAGCATATACCTGCCGGTGGTACGACGTCAATGGCGCCGCCGCCGACGCCGTCG
AACCCGTGGGCGTCGACGACACTGCCCCTCGTACGCGCCGGGACGCCTCTTGTGCGCGGTCATAGCCTCGAGGTG
ACGACGCTGAGCTGGTCGTGGGACGGGAAGCTCGTGACGGCGTCGGACGATTGCTTCGTTCGTCGATGGCAGCGG
AACGCGGCGCGGGCCGGCTACCTCCGGCAAGTGGGTGAGTTTGGGGGCGAGAGACATCTCGCCGGTTGGGCTGAG
GTGGGCGATGATTGGGATGTCGATGAGTGT
Transcript >Ophio5|2620
ATGGAGACACACCATTACTCAGACGAGGAGATGCCATCGAGCCCGCCTGCGGCTGCGTCAACCCAGCACGCCCAT
GGGTTTCTCTCCCCGACGAGGTCGCCCATGAGCTTCTCGACGAGATCGCCGTTGAGACTCCCGTCCAGATCCCCT
CCCAGATCCCCTCCGAGATCCCCGTCACGATCGACACGGATGAAGGAGAAGCGTGTTCCCTCGGTTACGCCGAGA
CGGCTTCGGACCTTCTTCACCCCCCGTACCCATCTATCTACGATCAGTCGAATGACGCTGGGGACTCTGGATTCC
GCTTCCGTCAACCGCCTGGCTTCTAGGCCGCTGTCTCCTCCTCCGAGTTCGGACCCGATCGAACCGCCCTCCTCG
CCGACAGAACGGCTTCAGGCCGTCGAGAACGCCAATAGGAAGAAACGTTCGGTGCCGCAGTCAGGGTCGCGGACG
AAGCGACGGCGAACTGTTCTGTCCGACGAAGAGCCCCAGTCGACAGTTGCCGACGAGAAAAAATTCGTGTCTGTC
AACGGCGTCAACGAGAGGCGCACTCTTAGCCAGTTCTTCAAAGCTAGTCGCAGAGGGGTCATGGGCTCGGGTGGA
AAGTCTCTCCAATGCAGTCCACCAATCCTCGCCGCACAGGCCGACTCATCCACGTCGCTCCGAGGATACCGACCG
CAGCCGATTCGAAAGCTGCGTAACCGCGGTTTCGAAGCCAGCCTACTCGACCGCGAGCATGGCTTCAGCACCCAT
ACCGGCAAACAATATCTGGCCTTTCCCACTTCCGATCCCAGAATAGAGACGGCCAATTTCTACAGCGACAGCTCC
GACGCCTACCACTGCACCCCCCTGGGCAATCAGCCCGGCACATCCATCCCCTTTAGCCTCGCGAGCTGCCACCGT
GCCTCGCTAACGGCCATCGGCGACGAACGAGGCCATGTGCGCTACTTTTCCACGGCCGGGGACGCCAGCCAGATG
GTGACGAGCTGGGTCAAGGTGCACGACAACGCCATCATGGATCTTGACTTCTCCGCCGACGACACTCGTCTGGCG
AGCGCATGTGGCGACAGGACGGGCCGTGTGCTTGATACTCAGACTCAATCCGTCGCCGTCGAGCTAGGTGAGCAC
TGGGACTCGCTCCGACAGGTCACCTTTCAGCCCGGCAGCGGCAACGGGAACGTGCTCGCCTCGTCGGACCGCGCG
GGCCGTGTCCAAGTCTGGGACCTCCGATGCTCCTCTCTGCCGGCCCAATGCTTCTCGTCGGCTGCGGACGGTGTT
GGTCGAGATCGGAGACTGGACATTGTGGCGGCCCGGACGGTCAACACCATCGACAGCGCGCACGAGCGTACCATG
CAGGGGAGCACGTCGTCTTCCTCAGTCACGGCCCTGCAGTGGCTGCCGGCCGGCCGCGAACACCTCCTGCTGACG
GGCTCGGAAGCCAACGGGTCCGTCAAGCTATGGGACACACGCTACATCAAAGCGCGGCGACAAAGACAAGCGGCG
GAGACGCCGATAGCAGTGACACCCGAGCCGGCGACACACGCGTGGCGCTCCTACGGCATCACGTCCATGACGCTC
GGCACCGACGCCGCACGGCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTACTCGACCAACCACCTCGTC
CTCGGCCACGCGCCCGAGTTGCTGGACGGAGCGAGCAAGCGCAAGCCCCTCGGCTCCCAAGGCCTCGGGCCGCTC
TACGGCCTCAAGAACGACAAGCTCCGCGTCGGCTCTTTCTACGTCAAGTGCGCCGTTCGTCCTGGCGGCGGCGGC
GGCGCGGACGAGCTCCTCGCCGTGGGCAGCTCCGACGGCTGTGCCGTTGTCTTCCCTACCAACGAACGCTACATG
CGGGCCGCGTGGGCTCGTCGCGAGCATATACCTGCCGGTGGTACGACGTCAATGGCGCCGCCGCCGACGCCGTCG
AACCCGTGGGCGTCGACGACACTGCCCCTCGTACGCGCCGGGACGCCTCTTGTGCGCGGTCATAGCCTCGAGGTG
ACGACGCTGAGCTGGTCGTGGGACGGGAAGCTCGTGACGGCGTCGGACGATTGCTTCGTTCGTCGATGGCAGCGG
AACGCGGCGCGGGCCGGCTACCTCCGGCAAGTGGGTGAGTTTGGGGGCGAGAGACATCTCGCCGGTTGGGCTGAG
GTGGGCGATGATTGGGATGTCGATGAGTGTTGA
Gene >Ophio5|2620
ATGGAGACACACCATTACTCAGACGAGGAGATGCCATCGAGCCCGCCTGCGGCTGCGTCAACCCAGCACGCCCAT
GGGTTTCTCTCCCCGACGAGGTCGCCCATGAGCTTCTCGACGAGATCGCCGTTGAGACTCCCGTCCAGATCCCCT
CCCAGATCCCCTCCGAGATCCCCGTCACGATCGACACGGATGAAGGAGAAGCGTGTTCCCTCGGTTACGCCGAGA
CGGCTTCGGACCTTCTTCACCCCCCGTACCCATCTATCTACGATCAGTCGAATGACGCTGGGGACTCTGGATTCC
GCTTCCGTCAACCGCCTGGCTTCTAGGCCGCTGTCTCCTCCTCCGAGTTCGGACCCGATCGAACCGCCCTCCTCG
CCGACAGAACGGCTTCAGGCCGTCGAGAACGCCAATAGGAAGAAACGTTCGGTGCCGCAGTCAGGGTCGCGGACG
AAGCGACGGCGAACTGTTCTGTCCGACGAAGAGCCCCAGTCGACAGTTGCCGACGAGAAAAAATTCGTGTCTGTC
AACGGCGTCAACGAGAGGCGCACTCTTGTGAGCGGCGACTACAGCCCTTACCCTTGGCCTCGTTGCTCACCGTTG
CAGAGCCAGTTCTTCAAAGCTAGTCGCAGAGGGGTCATGGGCTCGGGTGGAAAGTCTCTCCAATGCAGTCCACCA
ATCCTCGCCGCACAGGCCGACTCATCCACGGTAAGTCTCCCTCGTTGCCACAGCCTCCCTCCCTGTTCCTCTCAC
AGCCATCCACATTTGCTCTGGTTACGTCTAACTCGGTCTCGCAGTCGCTCCGAGGATACCGACCGCAGCCGATTC
GAAAGCTGCGTAACCGCGGTTTCGAAGCCAGCCTACTCGACCGCGAGCATGGCTTCAGCACCCATACCGGCAAAC
AATATCTGGCCTTTCCCACTTCCGATCCCAGAATAGAGACGGCCAATTTCTACAGCGACAGCTCCGACGCCTACC
ACTGCACCCCCCTGGGCAATCAGCCCGGCACATCCATCCCCTTTAGCCTCGCGAGCTGCCACCGTGCCTCGCTAA
CGGCCATCGGCGACGAACGAGGCCATGTGCGCTACTTTTCCACGGCCGGGGACGCCAGCCAGATGGTGACGAGCT
GGGTCAAGGTGCACGACAACGCCATCATGGATCTTGACTTCTCCGCCGACGACACTCGTCTGGCGAGCGCATGTG
GCGACAGGACGGGCCGTGTGCTTGATACTCAGACTCAATCCGTCGCCGTCGAGCTAGGTGAGCACTGGGACTCGC
TCCGACAGGTCACCTTTCAGCCCGGCAGCGGCAACGGGAACGTGCTCGCCTCGTCGGACCGCGCGGGCCGTGTCC
AAGTCTGGGACCTCCGATGCTCCTCTCTGCCGGCCCAATGCTTCTCGTCGGCTGCGGACGGTGTTGGTCGAGATC
GGAGACTGGACATTGTGGCGGCCCGGACGGTCAACACCATCGACAGCGCGCACGAGCGTACCATGCAGGGGAGCA
CGTCGTCTTCCTCAGTCACGGCCCTGCAGTGGCTGCCGGCCGGCCGCGAACACCTCCTGCTGACGGGCTCGGAAG
CCAACGGGTCCGTCAAGCTATGGGACACACGCTACATCAAAGCGCGGCGACAAAGACAAGCGGCGGAGACGCCGA
TAGCAGTGACACCCGAGCCGGCGACACACGCGTGGCGCTCCTACGGCATCACGTCCATGACGCTCGGCACCGACG
CCGCACGGCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTACTCGACCAACCACCTCGTCCTCGGCCACG
CGCCCGAGTTGCTGGACGGAGCGAGCAAGCGCAAGCCCCTCGGCTCCCAAGGCCTCGGGCCGCTCTACGGCCTCA
AGAACGACAAGCTCCGCGTCGGCTCTTTCTACGTCAAGTGCGCCGTTCGTCCTGGCGGCGGCGGCGGCGCGGACG
AGCTCCTCGCCGTGGGCAGCTCCGACGGCTGTGCCGTTGTCTTCCCTACCAACGAACGCTACATGCGGGCCGCGT
GGGCTCGTCGCGAGCATATACCTGCCGGTGGTACGACGTCAATGGCGCCGCCGCCGACGCCGTCGAACCCGTGGG
CGTCGACGACACTGCCCCTCGTACGCGCCGGGACGCCTCTTGTGCGCGGTCATAGCCTCGAGGTGACGACGCTGA
GCTGGTCGTGGGACGGGAAGCTCGTGACGGCGTCGGACGATTGCTTCGTTCGTCGATGGCAGCGGAACGCGGCGC
GGGCCGGCTACCTCCGGCAAGTGGGTGAGTTTGGGGGCGAGAGACATCTCGCCGGTTGGGCTGAGGTGGGCGATG
ATTGGGATGTCGATGAGTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail