Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2615
Gene name
Locationscaffold_213:8917..10079
Strand+
Gene length (bp)1162
Transcript length (bp)1005
Coding sequence length (bp)1002
Protein length (aa) 334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 2.5E-20 37 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12713|CHI33_TRIHA Endochitinase 33 OS=Trichoderma harzianum GN=chit33 PE=1 SV=1 33 333 1.0E-123
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 30 334 4.0E-79
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 24 323 6.0E-61
sp|P40953|CHI2_CANAL Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT2 PE=1 SV=1 37 322 4.0E-55
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 14 331 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12713|CHI33_TRIHA Endochitinase 33 OS=Trichoderma harzianum GN=chit33 PE=1 SV=1 33 333 1.0E-123
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 30 334 4.0E-79
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 24 323 6.0E-61
sp|P40953|CHI2_CANAL Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT2 PE=1 SV=1 37 322 4.0E-55
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 14 331 4.0E-54
sp|P40954|CHI3_CANAL Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT3 PE=1 SV=2 35 331 3.0E-53
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 36 331 4.0E-51
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 31 331 7.0E-51
sp|Q5AAH2|CHI1_CANAL Chitinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT1 PE=1 SV=1 32 334 8.0E-49
sp|P46876|CHI1_CANAX Chitinase 1 OS=Candida albicans GN=CHT1 PE=3 SV=2 32 334 1.0E-48
sp|G5EB30|CHIA1_EMENI Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiA PE=1 SV=1 2 333 1.0E-41
sp|Q92223|CHIA1_EMEND Endochitinase A OS=Emericella nidulans GN=chiA PE=2 SV=3 2 333 1.0E-41
sp|P54197|CHI2_COCP7 Endochitinase 2 OS=Coccidioides posadasii (strain C735) GN=CTS2 PE=3 SV=2 33 315 3.0E-37
sp|Q1EAR5|CHI2_COCIM Endochitinase 2 OS=Coccidioides immitis (strain RS) GN=CTS2 PE=3 SV=2 33 315 4.0E-37
sp|Q873Y0|CHIA1_ASPFM Endochitinase A1 OS=Neosartorya fumigata GN=chiA1 PE=1 SV=1 14 315 3.0E-36
sp|Q4WEP7|CHIA1_ASPFU Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiA1 PE=3 SV=1 14 317 7.0E-36
sp|A2QUQ2|CHIA1_ASPNC Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ctcA PE=2 SV=1 33 317 2.0E-34
sp|Q9C105|YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.04c PE=3 SV=1 40 333 2.0E-33
sp|P29061|CHIB_TOBAC Basic endochitinase OS=Nicotiana tabacum PE=2 SV=1 31 315 6.0E-32
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 13 314 1.0E-31
sp|Q4U4T0|CHI2_METAN Endochitinase 2 OS=Metarhizium anisopliae GN=chi2 PE=1 SV=1 13 314 2.0E-31
sp|D4AT07|CHI1_ARTBC Probable endochitinase ARB_07371 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07371 PE=3 SV=1 33 315 8.0E-30
sp|P36910|CHIE_BETVU Acidic endochitinase SE2 OS=Beta vulgaris GN=SE2 PE=1 SV=1 27 314 3.0E-29
sp|P36908|CHIA_CICAR Acidic endochitinase OS=Cicer arietinum PE=2 SV=1 34 315 5.0E-29
sp|P19172|CHIA_ARATH Acidic endochitinase OS=Arabidopsis thaliana GN=CHIB1 PE=2 SV=2 14 314 9.0E-28
sp|P23472|CHLY_HEVBR Hevamine-A OS=Hevea brasiliensis PE=1 SV=2 37 330 6.0E-27
sp|P29060|CHIA_TOBAC Acidic endochitinase OS=Nicotiana tabacum PE=1 SV=1 34 333 1.0E-26
sp|P29024|CHIA_PHAAN Acidic endochitinase OS=Phaseolus angularis PE=2 SV=1 32 315 3.0E-26
sp|E9ENC6|CHI3_METRA Endochitinase 3 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi3 PE=3 SV=1 7 333 5.0E-25
sp|P51614|CHIT3_VITVI Acidic endochitinase OS=Vitis vinifera GN=CHIT3 PE=2 SV=1 30 314 6.0E-25
sp|P17541|CHIA_CUCSA Acidic endochitinase OS=Cucumis sativus PE=1 SV=1 30 314 2.0E-22
sp|Q6QDR4|CHI3_METAN Endochitinase 3 (Fragment) OS=Metarhizium anisopliae GN=chi3 PE=1 SV=1 20 328 3.0E-21
sp|P49347|CONB_CANEN Concanavalin B OS=Canavalia ensiformis PE=1 SV=1 33 315 1.0E-15
sp|Q7GCM7|XIP1_ORYSJ Xylanase inhibitor protein 1 OS=Oryza sativa subsp. japonica GN=RIXI PE=1 SV=1 1 315 4.0E-13
sp|Q8L5C6|XIP1_WHEAT Xylanase inhibitor protein 1 OS=Triticum aestivum GN=XIPI PE=1 SV=2 36 315 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0989 0.0533 0.9251 0.0508 0.1013 0.062 0.1747 0.2462 0.1322 0.0033

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999514

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH18 1.6E-24 35 290

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup175
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6129
Ophiocordyceps australis 1348a (Ghana) OphauG2|7112
Ophiocordyceps australis map64 (Brazil) OphauB2|5114
Ophiocordyceps australis map64 (Brazil) OphauB2|5509
Ophiocordyceps camponoti-floridani Ophcf2|00800
Ophiocordyceps camponoti-floridani Ophcf2|05574
Ophiocordyceps camponoti-rufipedis Ophun1|1902
Ophiocordyceps camponoti-rufipedis Ophun1|7604
Ophiocordyceps kimflemingae Ophio5|2615 (this protein)
Ophiocordyceps kimflemingae Ophio5|6743
Ophiocordyceps subramaniannii Hirsu2|242
Ophiocordyceps subramaniannii Hirsu2|7599

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2615
MPSLGRSLACTAGLLALASSAPAPTPASNHSAAASNLAVYWGQNSYGQGSGPNVQRNLAYYCENTNINIVPLAFM
NGITPPIVNFANAGDKCDTFNGSGLLHCPEIEADIQKCQTQNKKIIVLSLGGATYTQGGWASPAEAEKAADMVWA
MFGPVSSSYVQRPFGSAVVDGFDFDFEAITNNLPAFGARLRALMDAATSSGGKRFYLTAAPQCVFPDAAVGSTLE
AVPFDYVFIQFYNNWCGVSNFQPGASVQPAFNMDVWDTWAKRSKNPAVKALLGIPANVGAGGGYVRGPKLAAAIQ
YATGFSSFGGVMMWDMSQLYANPGFLEEIMADLS
Coding >Ophio5|2615
ATGCCTTCTTTGGGCCGTTCCCTCGCCTGTACCGCGGGCTTGCTCGCTCTCGCCTCGTCGGCCCCAGCCCCGACC
CCGGCTAGCAACCACTCAGCGGCCGCCAGCAATCTAGCTGTCTACTGGGGGCAAAACTCGTATGGCCAGGGCAGC
GGCCCAAACGTTCAGCGAAACCTCGCCTACTACTGCGAGAACACAAACATCAACATCGTTCCGCTGGCTTTTATG
AACGGCATCACGCCTCCCATCGTCAACTTCGCCAACGCCGGCGACAAATGTGATACCTTCAACGGCTCGGGCCTC
CTCCACTGCCCCGAAATCGAAGCCGACATCCAGAAATGCCAGACGCAGAACAAGAAGATCATCGTCCTCTCCCTC
GGTGGCGCGACCTACACCCAGGGCGGCTGGGCGTCCCCGGCCGAGGCTGAAAAGGCGGCCGACATGGTCTGGGCC
ATGTTCGGTCCCGTCTCGTCCAGCTATGTCCAGAGACCGTTCGGCTCCGCCGTCGTCGACGGCTTCGACTTTGAC
TTTGAGGCCATCACCAACAACTTGCCCGCGTTCGGCGCCCGGCTCCGGGCCTTGATGGACGCGGCCACGAGCTCC
GGAGGCAAACGATTCTACCTGACGGCCGCGCCGCAGTGTGTGTTCCCCGACGCAGCCGTCGGCTCGACGCTCGAA
GCCGTACCGTTCGACTACGTCTTCATCCAGTTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCCCGGCGCC
TCCGTCCAGCCCGCCTTCAACATGGACGTGTGGGATACCTGGGCCAAGCGCAGCAAGAACCCGGCCGTCAAGGCC
CTGCTCGGAATCCCCGCCAATGTCGGTGCCGGCGGAGGCTACGTCCGTGGACCCAAACTTGCCGCTGCCATCCAG
TACGCCACCGGCTTTTCATCGTTTGGCGGTGTCATGATGTGGGATATGAGCCAGCTTTATGCCAATCCTGGCTTT
TTGGAGGAGATTATGGCCGATTTGTCG
Transcript >Ophio5|2615
ATGCCTTCTTTGGGCCGTTCCCTCGCCTGTACCGCGGGCTTGCTCGCTCTCGCCTCGTCGGCCCCAGCCCCGACC
CCGGCTAGCAACCACTCAGCGGCCGCCAGCAATCTAGCTGTCTACTGGGGGCAAAACTCGTATGGCCAGGGCAGC
GGCCCAAACGTTCAGCGAAACCTCGCCTACTACTGCGAGAACACAAACATCAACATCGTTCCGCTGGCTTTTATG
AACGGCATCACGCCTCCCATCGTCAACTTCGCCAACGCCGGCGACAAATGTGATACCTTCAACGGCTCGGGCCTC
CTCCACTGCCCCGAAATCGAAGCCGACATCCAGAAATGCCAGACGCAGAACAAGAAGATCATCGTCCTCTCCCTC
GGTGGCGCGACCTACACCCAGGGCGGCTGGGCGTCCCCGGCCGAGGCTGAAAAGGCGGCCGACATGGTCTGGGCC
ATGTTCGGTCCCGTCTCGTCCAGCTATGTCCAGAGACCGTTCGGCTCCGCCGTCGTCGACGGCTTCGACTTTGAC
TTTGAGGCCATCACCAACAACTTGCCCGCGTTCGGCGCCCGGCTCCGGGCCTTGATGGACGCGGCCACGAGCTCC
GGAGGCAAACGATTCTACCTGACGGCCGCGCCGCAGTGTGTGTTCCCCGACGCAGCCGTCGGCTCGACGCTCGAA
GCCGTACCGTTCGACTACGTCTTCATCCAGTTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCCCGGCGCC
TCCGTCCAGCCCGCCTTCAACATGGACGTGTGGGATACCTGGGCCAAGCGCAGCAAGAACCCGGCCGTCAAGGCC
CTGCTCGGAATCCCCGCCAATGTCGGTGCCGGCGGAGGCTACGTCCGTGGACCCAAACTTGCCGCTGCCATCCAG
TACGCCACCGGCTTTTCATCGTTTGGCGGTGTCATGATGTGGGATATGAGCCAGCTTTATGCCAATCCTGGCTTT
TTGGAGGAGATTATGGCCGATTTGTCGTGA
Gene >Ophio5|2615
ATGCCTTCTTTGGGCCGTTCCCTCGCCTGTACCGCGGGCTTGCTCGCTCTCGCCTCGTCGGCCCCAGCCCCGACC
CCGGCTAGCAACCACTCAGCGGCCGCCAGCAATCTAGCTGTCTACTGGGGTGAGAAGGGCTCTCCCTCGGGCCAG
GAGACGAGGCACAGACGCAAGATGCACATGACTGACGCTTCTCTCTTTGTTCTCTCGCCTCAGGGCAAAACTCGT
ATGGCCAGGGCAGCGGCCCAAACGTTCAGCGAAACCTCGCCTACTACTGCGAGAGTCAGTTGTGCTTGTGTTTCA
TGACGAGGGGGGGGGGGGAGGGATAACTTTGAGCTGACATGTTCAAGACACAAACATCAACATCGTTCCGCTGGC
TTTTATGAACGGCATCACGCCTCCCATCGTCAACTTCGCCAACGCCGGCGACAAATGTGATACCTTCAACGGCTC
GGGCCTCCTCCACTGCCCCGAAATCGAAGCCGACATCCAGAAATGCCAGACGCAGAACAAGAAGATCATCGTCCT
CTCCCTCGGTGGCGCGACCTACACCCAGGGCGGCTGGGCGTCCCCGGCCGAGGCTGAAAAGGCGGCCGACATGGT
CTGGGCCATGTTCGGTCCCGTCTCGTCCAGCTATGTCCAGAGACCGTTCGGCTCCGCCGTCGTCGACGGCTTCGA
CTTTGACTTTGAGGCCATCACCAACAACTTGCCCGCGTTCGGCGCCCGGCTCCGGGCCTTGATGGACGCGGCCAC
GAGCTCCGGAGGCAAACGATTCTACCTGACGGCCGCGCCGCAGTGTGTGTTCCCCGACGCAGCCGTCGGCTCGAC
GCTCGAAGCCGTACCGTTCGACTACGTCTTCATCCAGTTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCC
CGGCGCCTCCGTCCAGCCCGCCTTCAACATGGACGTGTGGGATACCTGGGCCAAGCGCAGCAAGAACCCGGCCGT
CAAGGCCCTGCTCGGAATCCCCGCCAATGTCGGTGCCGGCGGAGGCTACGTCCGTGGACCCAAACTTGCCGCTGC
CATCCAGTACGCCACCGGCTTTTCATCGTTTGGCGGTGTCATGATGTGGGATATGAGCCAGCTTTATGCCAATCC
TGGCTTTTTGGAGGAGATTATGGCCGATTTGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail