Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2615
Gene name
Locationscaffold_213:8917..10079
Strand+
Gene length (bp)1162
Transcript length (bp)1005
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 2.5E-20 37 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12713|CHI33_TRIHA Endochitinase 33 OS=Trichoderma harzianum GN=chit33 PE=1 SV=1 33 333 1.0E-123
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 30 334 4.0E-79
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 24 323 6.0E-61
sp|P40953|CHI2_CANAL Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT2 PE=1 SV=1 37 322 4.0E-55
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 14 331 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12713|CHI33_TRIHA Endochitinase 33 OS=Trichoderma harzianum GN=chit33 PE=1 SV=1 33 333 1.0E-123
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 30 334 4.0E-79
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 24 323 6.0E-61
sp|P40953|CHI2_CANAL Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT2 PE=1 SV=1 37 322 4.0E-55
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 14 331 4.0E-54
sp|P40954|CHI3_CANAL Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT3 PE=1 SV=2 35 331 3.0E-53
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 36 331 4.0E-51
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 31 331 7.0E-51
sp|Q5AAH2|CHI1_CANAL Chitinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT1 PE=1 SV=1 32 334 8.0E-49
sp|P46876|CHI1_CANAX Chitinase 1 OS=Candida albicans GN=CHT1 PE=3 SV=2 32 334 1.0E-48
sp|G5EB30|CHIA1_EMENI Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiA PE=1 SV=1 2 333 1.0E-41
sp|Q92223|CHIA1_EMEND Endochitinase A OS=Emericella nidulans GN=chiA PE=2 SV=3 2 333 1.0E-41
sp|P54197|CHI2_COCP7 Endochitinase 2 OS=Coccidioides posadasii (strain C735) GN=CTS2 PE=3 SV=2 33 315 3.0E-37
sp|Q1EAR5|CHI2_COCIM Endochitinase 2 OS=Coccidioides immitis (strain RS) GN=CTS2 PE=3 SV=2 33 315 4.0E-37
sp|Q873Y0|CHIA1_ASPFM Endochitinase A1 OS=Neosartorya fumigata GN=chiA1 PE=1 SV=1 14 315 3.0E-36
sp|Q4WEP7|CHIA1_ASPFU Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiA1 PE=3 SV=1 14 317 7.0E-36
sp|A2QUQ2|CHIA1_ASPNC Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ctcA PE=2 SV=1 33 317 2.0E-34
sp|Q9C105|YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.04c PE=3 SV=1 40 333 2.0E-33
sp|P29061|CHIB_TOBAC Basic endochitinase OS=Nicotiana tabacum PE=2 SV=1 31 315 6.0E-32
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 13 314 1.0E-31
sp|Q4U4T0|CHI2_METAN Endochitinase 2 OS=Metarhizium anisopliae GN=chi2 PE=1 SV=1 13 314 2.0E-31
sp|D4AT07|CHI1_ARTBC Probable endochitinase ARB_07371 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07371 PE=3 SV=1 33 315 8.0E-30
sp|P36910|CHIE_BETVU Acidic endochitinase SE2 OS=Beta vulgaris GN=SE2 PE=1 SV=1 27 314 3.0E-29
sp|P36908|CHIA_CICAR Acidic endochitinase OS=Cicer arietinum PE=2 SV=1 34 315 5.0E-29
sp|P19172|CHIA_ARATH Acidic endochitinase OS=Arabidopsis thaliana GN=CHIB1 PE=2 SV=2 14 314 9.0E-28
sp|P23472|CHLY_HEVBR Hevamine-A OS=Hevea brasiliensis PE=1 SV=2 37 330 6.0E-27
sp|P29060|CHIA_TOBAC Acidic endochitinase OS=Nicotiana tabacum PE=1 SV=1 34 333 1.0E-26
sp|P29024|CHIA_PHAAN Acidic endochitinase OS=Phaseolus angularis PE=2 SV=1 32 315 3.0E-26
sp|E9ENC6|CHI3_METRA Endochitinase 3 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi3 PE=3 SV=1 7 333 5.0E-25
sp|P51614|CHIT3_VITVI Acidic endochitinase OS=Vitis vinifera GN=CHIT3 PE=2 SV=1 30 314 6.0E-25
sp|P17541|CHIA_CUCSA Acidic endochitinase OS=Cucumis sativus PE=1 SV=1 30 314 2.0E-22
sp|Q6QDR4|CHI3_METAN Endochitinase 3 (Fragment) OS=Metarhizium anisopliae GN=chi3 PE=1 SV=1 20 328 3.0E-21
sp|P49347|CONB_CANEN Concanavalin B OS=Canavalia ensiformis PE=1 SV=1 33 315 1.0E-15
sp|Q7GCM7|XIP1_ORYSJ Xylanase inhibitor protein 1 OS=Oryza sativa subsp. japonica GN=RIXI PE=1 SV=1 1 315 4.0E-13
sp|Q8L5C6|XIP1_WHEAT Xylanase inhibitor protein 1 OS=Triticum aestivum GN=XIPI PE=1 SV=2 36 315 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2615
MPSLGRSLACTAGLLALASSAPAPTPASNHSAAASNLAVYWGQNSYGQGSGPNVQRNLAYYCENTNINIVPLAFM
NGITPPIVNFANAGDKCDTFNGSGLLHCPEIEADIQKCQTQNKKIIVLSLGGATYTQGGWASPAEAEKAADMVWA
MFGPVSSSYVQRPFGSAVVDGFDFDFEAITNNLPAFGARLRALMDAATSSGGKRFYLTAAPQCVFPDAAVGSTLE
AVPFDYVFIQFYNNWCGVSNFQPGASVQPAFNMDVWDTWAKRSKNPAVKALLGIPANVGAGGGYVRGPKLAAAIQ
YATGFSSFGGVMMWDMSQLYANPGFLEEIMADLS
Coding >Ophio5|2615
ATGCCTTCTTTGGGCCGTTCCCTCGCCTGTACCGCGGGCTTGCTCGCTCTCGCCTCGTCGGCCCCAGCCCCGACC
CCGGCTAGCAACCACTCAGCGGCCGCCAGCAATCTAGCTGTCTACTGGGGGCAAAACTCGTATGGCCAGGGCAGC
GGCCCAAACGTTCAGCGAAACCTCGCCTACTACTGCGAGAACACAAACATCAACATCGTTCCGCTGGCTTTTATG
AACGGCATCACGCCTCCCATCGTCAACTTCGCCAACGCCGGCGACAAATGTGATACCTTCAACGGCTCGGGCCTC
CTCCACTGCCCCGAAATCGAAGCCGACATCCAGAAATGCCAGACGCAGAACAAGAAGATCATCGTCCTCTCCCTC
GGTGGCGCGACCTACACCCAGGGCGGCTGGGCGTCCCCGGCCGAGGCTGAAAAGGCGGCCGACATGGTCTGGGCC
ATGTTCGGTCCCGTCTCGTCCAGCTATGTCCAGAGACCGTTCGGCTCCGCCGTCGTCGACGGCTTCGACTTTGAC
TTTGAGGCCATCACCAACAACTTGCCCGCGTTCGGCGCCCGGCTCCGGGCCTTGATGGACGCGGCCACGAGCTCC
GGAGGCAAACGATTCTACCTGACGGCCGCGCCGCAGTGTGTGTTCCCCGACGCAGCCGTCGGCTCGACGCTCGAA
GCCGTACCGTTCGACTACGTCTTCATCCAGTTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCCCGGCGCC
TCCGTCCAGCCCGCCTTCAACATGGACGTGTGGGATACCTGGGCCAAGCGCAGCAAGAACCCGGCCGTCAAGGCC
CTGCTCGGAATCCCCGCCAATGTCGGTGCCGGCGGAGGCTACGTCCGTGGACCCAAACTTGCCGCTGCCATCCAG
TACGCCACCGGCTTTTCATCGTTTGGCGGTGTCATGATGTGGGATATGAGCCAGCTTTATGCCAATCCTGGCTTT
TTGGAGGAGATTATGGCCGATTTGTCG
Transcript >Ophio5|2615
ATGCCTTCTTTGGGCCGTTCCCTCGCCTGTACCGCGGGCTTGCTCGCTCTCGCCTCGTCGGCCCCAGCCCCGACC
CCGGCTAGCAACCACTCAGCGGCCGCCAGCAATCTAGCTGTCTACTGGGGGCAAAACTCGTATGGCCAGGGCAGC
GGCCCAAACGTTCAGCGAAACCTCGCCTACTACTGCGAGAACACAAACATCAACATCGTTCCGCTGGCTTTTATG
AACGGCATCACGCCTCCCATCGTCAACTTCGCCAACGCCGGCGACAAATGTGATACCTTCAACGGCTCGGGCCTC
CTCCACTGCCCCGAAATCGAAGCCGACATCCAGAAATGCCAGACGCAGAACAAGAAGATCATCGTCCTCTCCCTC
GGTGGCGCGACCTACACCCAGGGCGGCTGGGCGTCCCCGGCCGAGGCTGAAAAGGCGGCCGACATGGTCTGGGCC
ATGTTCGGTCCCGTCTCGTCCAGCTATGTCCAGAGACCGTTCGGCTCCGCCGTCGTCGACGGCTTCGACTTTGAC
TTTGAGGCCATCACCAACAACTTGCCCGCGTTCGGCGCCCGGCTCCGGGCCTTGATGGACGCGGCCACGAGCTCC
GGAGGCAAACGATTCTACCTGACGGCCGCGCCGCAGTGTGTGTTCCCCGACGCAGCCGTCGGCTCGACGCTCGAA
GCCGTACCGTTCGACTACGTCTTCATCCAGTTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCCCGGCGCC
TCCGTCCAGCCCGCCTTCAACATGGACGTGTGGGATACCTGGGCCAAGCGCAGCAAGAACCCGGCCGTCAAGGCC
CTGCTCGGAATCCCCGCCAATGTCGGTGCCGGCGGAGGCTACGTCCGTGGACCCAAACTTGCCGCTGCCATCCAG
TACGCCACCGGCTTTTCATCGTTTGGCGGTGTCATGATGTGGGATATGAGCCAGCTTTATGCCAATCCTGGCTTT
TTGGAGGAGATTATGGCCGATTTGTCGTGA
Gene >Ophio5|2615
ATGCCTTCTTTGGGCCGTTCCCTCGCCTGTACCGCGGGCTTGCTCGCTCTCGCCTCGTCGGCCCCAGCCCCGACC
CCGGCTAGCAACCACTCAGCGGCCGCCAGCAATCTAGCTGTCTACTGGGGTGAGAAGGGCTCTCCCTCGGGCCAG
GAGACGAGGCACAGACGCAAGATGCACATGACTGACGCTTCTCTCTTTGTTCTCTCGCCTCAGGGCAAAACTCGT
ATGGCCAGGGCAGCGGCCCAAACGTTCAGCGAAACCTCGCCTACTACTGCGAGAGTCAGTTGTGCTTGTGTTTCA
TGACGAGGGGGGGGGGGGAGGGATAACTTTGAGCTGACATGTTCAAGACACAAACATCAACATCGTTCCGCTGGC
TTTTATGAACGGCATCACGCCTCCCATCGTCAACTTCGCCAACGCCGGCGACAAATGTGATACCTTCAACGGCTC
GGGCCTCCTCCACTGCCCCGAAATCGAAGCCGACATCCAGAAATGCCAGACGCAGAACAAGAAGATCATCGTCCT
CTCCCTCGGTGGCGCGACCTACACCCAGGGCGGCTGGGCGTCCCCGGCCGAGGCTGAAAAGGCGGCCGACATGGT
CTGGGCCATGTTCGGTCCCGTCTCGTCCAGCTATGTCCAGAGACCGTTCGGCTCCGCCGTCGTCGACGGCTTCGA
CTTTGACTTTGAGGCCATCACCAACAACTTGCCCGCGTTCGGCGCCCGGCTCCGGGCCTTGATGGACGCGGCCAC
GAGCTCCGGAGGCAAACGATTCTACCTGACGGCCGCGCCGCAGTGTGTGTTCCCCGACGCAGCCGTCGGCTCGAC
GCTCGAAGCCGTACCGTTCGACTACGTCTTCATCCAGTTCTACAACAACTGGTGCGGCGTCTCCAACTTCCAGCC
CGGCGCCTCCGTCCAGCCCGCCTTCAACATGGACGTGTGGGATACCTGGGCCAAGCGCAGCAAGAACCCGGCCGT
CAAGGCCCTGCTCGGAATCCCCGCCAATGTCGGTGCCGGCGGAGGCTACGTCCGTGGACCCAAACTTGCCGCTGC
CATCCAGTACGCCACCGGCTTTTCATCGTTTGGCGGTGTCATGATGTGGGATATGAGCCAGCTTTATGCCAATCC
TGGCTTTTTGGAGGAGATTATGGCCGATTTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail