Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2612
Gene name
Locationscaffold_213:26..1394
Strand-
Gene length (bp)1368
Transcript length (bp)1368
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5833 0.5025 0.0872 0.1028 0.4396 0.0059 0.2055 0.3882 0.0928 0.0225

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup377
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1721
Ophiocordyceps australis 1348a (Ghana) OphauG2|6957
Ophiocordyceps australis map64 (Brazil) OphauB2|7725
Ophiocordyceps camponoti-floridani Ophcf2|05576
Ophiocordyceps camponoti-rufipedis Ophun1|7602
Ophiocordyceps kimflemingae Ophio5|2612 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1069
Ophiocordyceps subramaniannii Hirsu2|5673
Ophiocordyceps subramaniannii Hirsu2|5701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2612
MATTSSALGQHDLLLCILDLLSFPDLVSLSMVNKFSRYVTEPRLYATVEAAWALESTPSASLLLRTLLDRPELSG
CVRHLRLVGHGFHHDDDDDDAVNEPPARRLDSDCLTKASAFILSTGVPFANFWIHELESGTADAVVATLLATMSN
LQSLHLDPNFTVRCRILGKLFHSSLIEASEHHQLPAFPNLRRVTFSPRYNQHLQLFANNTSDVLPLFHLRNLQQL
SVSIDNPFHFAWPGTRPKPSHLESLEVFRLREAPLLSLLTPLQKLRKLHWHWFYQPHLDEGLSTNIIQLDVMTQA
FKQVSHTLTDLTIEAEAPRSCTMAGHYYQSLPLELWGSLGDMVHLRALRRLSLPWVFLMGFSESSTKCPQLPLST
SLEVLTLTGDLADNEQWEWCHDSILSAIKSTLDFWHRPLSSSLRRIVLPIPLGCGQLTDGREKELQDIGASAGLE
LGWKR
Coding >Ophio5|2612
ATGGCGACGACGTCGTCGGCTCTCGGCCAGCATGACCTGCTGCTCTGTATCCTCGACCTGCTCTCCTTCCCCGAC
CTCGTCTCCCTGAGCATGGTGAACAAATTCAGCCGCTACGTCACCGAGCCTCGTCTTTACGCCACCGTCGAGGCT
GCTTGGGCGCTGGAATCCACCCCGTCGGCGTCTCTGCTGTTGCGAACACTTCTCGATAGGCCGGAACTGTCGGGT
TGTGTTCGCCATCTGCGTCTTGTCGGTCATGGCTTTCATCATGATGATGATGATGATGATGCCGTCAATGAGCCG
CCCGCTCGTCGCCTCGACTCGGACTGCTTGACCAAGGCTTCGGCATTCATCCTATCAACAGGGGTGCCTTTCGCC
AACTTCTGGATACACGAGCTGGAATCGGGTACCGCCGACGCTGTTGTGGCAACCCTGTTAGCGACCATGTCCAAT
CTGCAATCCCTTCACCTTGACCCCAATTTCACGGTCCGCTGTCGTATTTTGGGAAAGCTATTCCACAGCTCCTTG
ATCGAAGCCTCAGAACATCATCAGCTACCTGCCTTTCCAAATCTCCGCCGTGTCACCTTCTCCCCCAGGTACAAC
CAACACCTCCAGCTCTTTGCCAACAACACGTCTGATGTCCTCCCCCTGTTTCACCTGCGGAATCTTCAACAGCTC
TCTGTCTCGATTGACAACCCATTCCATTTCGCCTGGCCTGGAACGAGGCCAAAGCCTTCCCATTTAGAGTCGCTC
GAGGTTTTCAGGCTACGAGAGGCGCCGCTGCTATCGCTTCTCACTCCTCTCCAAAAGCTTCGAAAGCTGCATTGG
CACTGGTTTTATCAGCCGCATCTCGATGAGGGATTGAGCACGAATATCATTCAGCTGGATGTCATGACGCAAGCC
TTTAAACAAGTGTCTCATACACTCACCGACTTGACCATCGAAGCGGAAGCACCACGTTCTTGCACCATGGCCGGG
CACTACTATCAGTCTCTCCCGCTGGAACTATGGGGATCACTAGGCGACATGGTTCACCTGCGCGCGCTCAGACGA
TTATCCCTTCCCTGGGTTTTCCTCATGGGCTTTTCTGAGTCGTCGACGAAATGCCCGCAGCTCCCGCTTTCTACA
AGCCTCGAGGTGCTCACCCTGACAGGGGATTTAGCGGATAACGAGCAGTGGGAATGGTGCCATGATTCCATCCTA
TCTGCCATCAAGTCCACGCTTGACTTTTGGCATCGGCCGCTGTCTTCAAGTCTCCGCCGTATCGTTCTGCCTATT
CCCCTCGGATGTGGCCAACTGACGGATGGAAGAGAAAAGGAACTACAAGATATAGGGGCAAGTGCAGGACTGGAG
TTGGGTTGGAAGCGA
Transcript >Ophio5|2612
ATGGCGACGACGTCGTCGGCTCTCGGCCAGCATGACCTGCTGCTCTGTATCCTCGACCTGCTCTCCTTCCCCGAC
CTCGTCTCCCTGAGCATGGTGAACAAATTCAGCCGCTACGTCACCGAGCCTCGTCTTTACGCCACCGTCGAGGCT
GCTTGGGCGCTGGAATCCACCCCGTCGGCGTCTCTGCTGTTGCGAACACTTCTCGATAGGCCGGAACTGTCGGGT
TGTGTTCGCCATCTGCGTCTTGTCGGTCATGGCTTTCATCATGATGATGATGATGATGATGCCGTCAATGAGCCG
CCCGCTCGTCGCCTCGACTCGGACTGCTTGACCAAGGCTTCGGCATTCATCCTATCAACAGGGGTGCCTTTCGCC
AACTTCTGGATACACGAGCTGGAATCGGGTACCGCCGACGCTGTTGTGGCAACCCTGTTAGCGACCATGTCCAAT
CTGCAATCCCTTCACCTTGACCCCAATTTCACGGTCCGCTGTCGTATTTTGGGAAAGCTATTCCACAGCTCCTTG
ATCGAAGCCTCAGAACATCATCAGCTACCTGCCTTTCCAAATCTCCGCCGTGTCACCTTCTCCCCCAGGTACAAC
CAACACCTCCAGCTCTTTGCCAACAACACGTCTGATGTCCTCCCCCTGTTTCACCTGCGGAATCTTCAACAGCTC
TCTGTCTCGATTGACAACCCATTCCATTTCGCCTGGCCTGGAACGAGGCCAAAGCCTTCCCATTTAGAGTCGCTC
GAGGTTTTCAGGCTACGAGAGGCGCCGCTGCTATCGCTTCTCACTCCTCTCCAAAAGCTTCGAAAGCTGCATTGG
CACTGGTTTTATCAGCCGCATCTCGATGAGGGATTGAGCACGAATATCATTCAGCTGGATGTCATGACGCAAGCC
TTTAAACAAGTGTCTCATACACTCACCGACTTGACCATCGAAGCGGAAGCACCACGTTCTTGCACCATGGCCGGG
CACTACTATCAGTCTCTCCCGCTGGAACTATGGGGATCACTAGGCGACATGGTTCACCTGCGCGCGCTCAGACGA
TTATCCCTTCCCTGGGTTTTCCTCATGGGCTTTTCTGAGTCGTCGACGAAATGCCCGCAGCTCCCGCTTTCTACA
AGCCTCGAGGTGCTCACCCTGACAGGGGATTTAGCGGATAACGAGCAGTGGGAATGGTGCCATGATTCCATCCTA
TCTGCCATCAAGTCCACGCTTGACTTTTGGCATCGGCCGCTGTCTTCAAGTCTCCGCCGTATCGTTCTGCCTATT
CCCCTCGGATGTGGCCAACTGACGGATGGAAGAGAAAAGGAACTACAAGATATAGGGGCAAGTGCAGGACTGGAG
TTGGGTTGGAAGCGATAG
Gene >Ophio5|2612
ATGGCGACGACGTCGTCGGCTCTCGGCCAGCATGACCTGCTGCTCTGTATCCTCGACCTGCTCTCCTTCCCCGAC
CTCGTCTCCCTGAGCATGGTGAACAAATTCAGCCGCTACGTCACCGAGCCTCGTCTTTACGCCACCGTCGAGGCT
GCTTGGGCGCTGGAATCCACCCCGTCGGCGTCTCTGCTGTTGCGAACACTTCTCGATAGGCCGGAACTGTCGGGT
TGTGTTCGCCATCTGCGTCTTGTCGGTCATGGCTTTCATCATGATGATGATGATGATGATGCCGTCAATGAGCCG
CCCGCTCGTCGCCTCGACTCGGACTGCTTGACCAAGGCTTCGGCATTCATCCTATCAACAGGGGTGCCTTTCGCC
AACTTCTGGATACACGAGCTGGAATCGGGTACCGCCGACGCTGTTGTGGCAACCCTGTTAGCGACCATGTCCAAT
CTGCAATCCCTTCACCTTGACCCCAATTTCACGGTCCGCTGTCGTATTTTGGGAAAGCTATTCCACAGCTCCTTG
ATCGAAGCCTCAGAACATCATCAGCTACCTGCCTTTCCAAATCTCCGCCGTGTCACCTTCTCCCCCAGGTACAAC
CAACACCTCCAGCTCTTTGCCAACAACACGTCTGATGTCCTCCCCCTGTTTCACCTGCGGAATCTTCAACAGCTC
TCTGTCTCGATTGACAACCCATTCCATTTCGCCTGGCCTGGAACGAGGCCAAAGCCTTCCCATTTAGAGTCGCTC
GAGGTTTTCAGGCTACGAGAGGCGCCGCTGCTATCGCTTCTCACTCCTCTCCAAAAGCTTCGAAAGCTGCATTGG
CACTGGTTTTATCAGCCGCATCTCGATGAGGGATTGAGCACGAATATCATTCAGCTGGATGTCATGACGCAAGCC
TTTAAACAAGTGTCTCATACACTCACCGACTTGACCATCGAAGCGGAAGCACCACGTTCTTGCACCATGGCCGGG
CACTACTATCAGTCTCTCCCGCTGGAACTATGGGGATCACTAGGCGACATGGTTCACCTGCGCGCGCTCAGACGA
TTATCCCTTCCCTGGGTTTTCCTCATGGGCTTTTCTGAGTCGTCGACGAAATGCCCGCAGCTCCCGCTTTCTACA
AGCCTCGAGGTGCTCACCCTGACAGGGGATTTAGCGGATAACGAGCAGTGGGAATGGTGCCATGATTCCATCCTA
TCTGCCATCAAGTCCACGCTTGACTTTTGGCATCGGCCGCTGTCTTCAAGTCTCCGCCGTATCGTTCTGCCTATT
CCCCTCGGATGTGGCCAACTGACGGATGGAAGAGAAAAGGAACTACAAGATATAGGGGCAAGTGCAGGACTGGAG
TTGGGTTGGAAGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail