Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2610
Gene name
Locationscaffold_212:25546..27294
Strand+
Gene length (bp)1748
Transcript length (bp)1632
Coding sequence length (bp)1629
Protein length (aa) 543

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.453 0.6276 0.0817 0.219 0.1274 0.0118 0.0213 0.0296 0.0055 0.0007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2241
Ophiocordyceps australis map64 (Brazil) OphauB2|5099
Ophiocordyceps camponoti-floridani Ophcf2|00782
Ophiocordyceps camponoti-rufipedis Ophun1|5258
Ophiocordyceps kimflemingae Ophio5|2610 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3776

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2610
MAHRSSRANDFEERDYYSAPRRPAAELDDRDYRPRAAPRSRAAVSEYDEVDVRLRDREMDRTPAFLRDDCRRPEA
GPMVLRQRDIETVDRHARSPSPVPVRRREMVRRPKSTSPPTMRGSEREHSHTRIVERERDRVRSPSVVRCRSPSP
LPVRFVERRRRSPSPVSQHDHIRIVERERQRAPSPSPSPSPPPPPPVIRGPTIEREVITHWTDIDHGMVRAKPPS
PPPCPPVRSRPRERETDIDISLSKDRTEVDIHRSNSRPRSKSRERKSRYREDDVVVRRDGNRLRVEEYSGPRRRA
QSAAPLCSPAEEEADYLTSKVDSRGRMGEAWGGATKDWSIVDVPPGTERVRMDGVGGASTDTTWSRYSGVRRTQF
IPERDGAVVPREPSPAPSRDRSSVYDREREIDVDIDRRVTRTPLPPPPPPSKELWTEITKDLVVREAIEQLGYEY
EETNWFYYIMDYLRYDDVIRLTELSESIRRVRKERAREIQWERDWRDEWERPFRRHMHDHHDHWRSREDWDDERV
RERDVVYDSRRPTRGYLR
Coding >Ophio5|2610
ATGGCGCACCGAAGCTCCAGGGCCAACGACTTCGAGGAGCGCGACTATTATTCCGCTCCTCGCCGTCCGGCTGCT
GAACTGGACGACCGCGATTATCGTCCTCGTGCCGCTCCTCGGTCCCGTGCGGCCGTGAGCGAGTACGACGAGGTC
GACGTGAGGCTGCGTGACCGAGAAATGGACCGCACGCCCGCCTTCTTAAGGGACGATTGTCGCCGACCGGAGGCT
GGTCCCATGGTTTTACGCCAGCGAGATATCGAGACGGTCGATCGCCACGCCCGGAGTCCCAGTCCAGTTCCAGTT
CGTCGGCGCGAAATGGTTCGTCGCCCAAAGAGCACTTCTCCGCCTACCATGCGCGGCAGCGAGCGTGAGCATTCG
CACACCAGGATCGTTGAGAGGGAGCGCGACAGGGTTAGGAGCCCCTCTGTCGTCCGCTGTCGCTCTCCTTCTCCG
CTACCGGTCAGGTTCGTTGAGCGTCGTCGTCGGTCTCCTTCACCCGTGAGCCAGCACGATCATATCCGCATCGTC
GAGAGGGAGAGGCAACGCGCCCCGTCCCCTTCGCCATCGCCGTCGCCTCCCCCGCCTCCGCCCGTCATCCGTGGC
CCGACGATTGAGCGCGAGGTTATTACCCACTGGACCGACATCGACCATGGAATGGTCCGGGCCAAACCGCCCAGC
CCGCCCCCTTGTCCTCCTGTCCGTTCGCGTCCAAGGGAGCGAGAGACGGACATTGACATCTCCCTCTCCAAGGAC
CGGACGGAGGTCGACATTCATCGGTCCAACAGCCGCCCGCGCTCCAAGAGCCGCGAGCGCAAGTCGCGCTACCGC
GAGGACGATGTCGTCGTCCGCCGCGATGGGAACCGTTTGAGGGTAGAAGAGTATTCCGGCCCGCGCCGACGAGCT
CAGTCGGCCGCCCCGCTCTGCTCTCCGGCCGAGGAAGAGGCCGATTACCTCACGTCCAAGGTCGACTCTCGGGGC
CGCATGGGCGAGGCCTGGGGCGGTGCCACCAAGGATTGGTCCATCGTCGACGTCCCGCCGGGGACGGAGAGAGTG
CGCATGGACGGTGTTGGCGGTGCTAGCACCGACACGACCTGGTCCAGGTACAGCGGCGTCAGGAGAACGCAATTC
ATCCCCGAGAGGGATGGGGCTGTCGTGCCAAGAGAGCCGTCACCTGCTCCATCGCGGGACCGCTCCAGCGTCTAC
GACCGTGAGAGGGAGATTGACGTCGACATCGACCGAAGAGTCACACGCACGCCCTTACCGCCGCCGCCGCCGCCG
TCCAAAGAACTTTGGACGGAGATCACCAAGGATCTCGTCGTTCGGGAAGCCATCGAGCAGCTGGGCTACGAGTAC
GAGGAGACCAACTGGTTTTATTACATCATGGACTACCTCCGATACGACGATGTTATTCGCCTGACGGAGCTGTCG
GAGAGCATCCGTCGGGTTCGAAAGGAGCGCGCTCGCGAGATCCAATGGGAGCGAGACTGGCGAGACGAGTGGGAG
CGGCCGTTCCGACGCCACATGCACGATCACCACGACCATTGGCGCTCGCGGGAGGATTGGGATGATGAGCGGGTG
AGGGAGCGTGATGTCGTATACGACAGCCGCAGACCGACTCGCGGATACCTCCGA
Transcript >Ophio5|2610
ATGGCGCACCGAAGCTCCAGGGCCAACGACTTCGAGGAGCGCGACTATTATTCCGCTCCTCGCCGTCCGGCTGCT
GAACTGGACGACCGCGATTATCGTCCTCGTGCCGCTCCTCGGTCCCGTGCGGCCGTGAGCGAGTACGACGAGGTC
GACGTGAGGCTGCGTGACCGAGAAATGGACCGCACGCCCGCCTTCTTAAGGGACGATTGTCGCCGACCGGAGGCT
GGTCCCATGGTTTTACGCCAGCGAGATATCGAGACGGTCGATCGCCACGCCCGGAGTCCCAGTCCAGTTCCAGTT
CGTCGGCGCGAAATGGTTCGTCGCCCAAAGAGCACTTCTCCGCCTACCATGCGCGGCAGCGAGCGTGAGCATTCG
CACACCAGGATCGTTGAGAGGGAGCGCGACAGGGTTAGGAGCCCCTCTGTCGTCCGCTGTCGCTCTCCTTCTCCG
CTACCGGTCAGGTTCGTTGAGCGTCGTCGTCGGTCTCCTTCACCCGTGAGCCAGCACGATCATATCCGCATCGTC
GAGAGGGAGAGGCAACGCGCCCCGTCCCCTTCGCCATCGCCGTCGCCTCCCCCGCCTCCGCCCGTCATCCGTGGC
CCGACGATTGAGCGCGAGGTTATTACCCACTGGACCGACATCGACCATGGAATGGTCCGGGCCAAACCGCCCAGC
CCGCCCCCTTGTCCTCCTGTCCGTTCGCGTCCAAGGGAGCGAGAGACGGACATTGACATCTCCCTCTCCAAGGAC
CGGACGGAGGTCGACATTCATCGGTCCAACAGCCGCCCGCGCTCCAAGAGCCGCGAGCGCAAGTCGCGCTACCGC
GAGGACGATGTCGTCGTCCGCCGCGATGGGAACCGTTTGAGGGTAGAAGAGTATTCCGGCCCGCGCCGACGAGCT
CAGTCGGCCGCCCCGCTCTGCTCTCCGGCCGAGGAAGAGGCCGATTACCTCACGTCCAAGGTCGACTCTCGGGGC
CGCATGGGCGAGGCCTGGGGCGGTGCCACCAAGGATTGGTCCATCGTCGACGTCCCGCCGGGGACGGAGAGAGTG
CGCATGGACGGTGTTGGCGGTGCTAGCACCGACACGACCTGGTCCAGGTACAGCGGCGTCAGGAGAACGCAATTC
ATCCCCGAGAGGGATGGGGCTGTCGTGCCAAGAGAGCCGTCACCTGCTCCATCGCGGGACCGCTCCAGCGTCTAC
GACCGTGAGAGGGAGATTGACGTCGACATCGACCGAAGAGTCACACGCACGCCCTTACCGCCGCCGCCGCCGCCG
TCCAAAGAACTTTGGACGGAGATCACCAAGGATCTCGTCGTTCGGGAAGCCATCGAGCAGCTGGGCTACGAGTAC
GAGGAGACCAACTGGTTTTATTACATCATGGACTACCTCCGATACGACGATGTTATTCGCCTGACGGAGCTGTCG
GAGAGCATCCGTCGGGTTCGAAAGGAGCGCGCTCGCGAGATCCAATGGGAGCGAGACTGGCGAGACGAGTGGGAG
CGGCCGTTCCGACGCCACATGCACGATCACCACGACCATTGGCGCTCGCGGGAGGATTGGGATGATGAGCGGGTG
AGGGAGCGTGATGTCGTATACGACAGCCGCAGACCGACTCGCGGATACCTCCGATGA
Gene >Ophio5|2610
ATGGCGCACCGAAGCTCCAGGGCCAACGACTTCGAGGAGCGCGACTATTATTCCGCTCCTCGCCGTCCGGCTGCT
GAACTGGACGACCGCGATTATCGTCCTCGTGCCGCTCCTCGGTCCCGTGCGGCCGTGAGCGAGTACGACGAGGTC
GACGTGAGGCTGCGTGACCGAGAAATGGACCGCACGCCCGCCTTCTTAAGGGACGATTGTCGCCGACCGGAGGCT
GGTCCCATGGTTTTACGCCAGCGAGATATCGAGACGGTCGATCGCCACGCCCGGAGTCCCAGTCCAGTTCCAGTT
CGTCGGCGCGAAATGGTTCGTCGCCCAAAGAGCACTTCTCCGCCTACCATGCGCGGCAGCGAGCGTGAGCATTCG
CACACCAGGATCGTTGAGAGGGAGCGCGACAGGGTTAGGAGCCCCTCTGTCGTCCGCTGTCGCTCTCCTTCTCCG
CTACCGGTCAGGTTCGTTGAGCGTCGTCGTCGGTCTCCTTCACCCGTGAGCCAGCACGATCATATCCGCATCGTC
GAGAGGGAGAGGCAACGCGCCCCGTCCCCTTCGCCATCGCCGTCGCCTCCCCCGCCTCCGCCCGTCATCCGTGGC
CCGACGATTGAGCGCGAGGTTATTACCCACTGGACCGACATCGACCATGGTGAGTGTTAGCCGTAGCAGCTCCGC
TTCTGGTCCTGCGGCTGATGATGATTCCCTAGGAATGGTCCGGGCCAAACCGCCCAGCCCGCCCCCTTGTCCTCC
TGTCCGTTCGCGTCCAAGGGAGCGAGAGACGGACATTGACATCTCCCTCTCCAAGGACCGGACGGAGGTCGACAT
TCATCGGTCCAACAGCCGCCCGCGCTCCAAGAGCCGCGAGCGCAAGTCGCGCTACCGCGAGGACGATGTCGTCGT
CCGCCGCGATGGGAACCGTTTGAGGGTAGAAGAGTATTCCGGCCCGCGCCGACGAGCTCAGTCGGCCGCCCCGCT
CTGCTCTCCGGCCGAGGAAGAGGCCGATTACCTCACGTCCAAGGTCGACTCTCGGGGCCGCATGGGCGAGGCCTG
GGGCGGTGCCACCAAGGATTGGTCCATCGTCGACGTCCCGCCGGGGACGGAGAGAGTGCGCATGGACGGTGTTGG
CGGTGCTAGCACCGACACGACCTGGTCCAGGTACAGCGGCGTCAGGAGAACGCAATTCATCCCCGAGAGGGATGG
GGCTGTCGTGCCAAGAGAGCCGTCACCTGCTCCATCGCGGGACCGCTCCAGCGTCTACGACCGTGAGAGGGAGAT
TGACGTCGACATCGACCGAAGAGTCACACGCACGCCCTTACCGCCGCCGCCGCCGCCGTCCAAAGAACTTTGGAC
GGAGATCACCAAGGATCTCGTCGTTCGGGAAGCCATCGAGCAGCTGGGCTACGAGTACGAGGAGACCAACTGGTT
TTATTACATCATGGACTACCTCCGATACGTGAGTTTTCCCCGGACTCAAAGCCACGAGGGCGAATGGAACACTGA
CAGTCACATAGGACGATGTTATTCGCCTGACGGAGCTGTCGGAGAGCATCCGTCGGGTTCGAAAGGAGCGCGCTC
GCGAGATCCAATGGGAGCGAGACTGGCGAGACGAGTGGGAGCGGCCGTTCCGACGCCACATGCACGATCACCACG
ACCATTGGCGCTCGCGGGAGGATTGGGATGATGAGCGGGTGAGGGAGCGTGATGTCGTATACGACAGCCGCAGAC
CGACTCGCGGATACCTCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail