Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2609
Gene name
Locationscaffold_212:23902..24811
Strand+
Gene length (bp)909
Transcript length (bp)909
Coding sequence length (bp)906
Protein length (aa) 302

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 2.3E-05 48 112

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6728 0.4056 0.5429 0.0762 0.3808 0.0128 0.0876 0.2496 0.1005 0.1133

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1318
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4854
Ophiocordyceps australis map64 (Brazil) OphauB2|5299
Ophiocordyceps camponoti-floridani Ophcf2|00783
Ophiocordyceps camponoti-rufipedis Ophun1|5259
Ophiocordyceps kimflemingae Ophio5|2609 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10676

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2609
MFLNRVQNTSAPLFACYIGGEAGREPQNALQKATVNLGNEEPDSNNDLGVTSYFLSDGQQAMMFDTLTSPVLASA
CLEMVQNSNQGGNQQNNIGQVQQVVLSHKHQDHIAGLSAPELKQAKVITQDNTRQALAQANSRPPDQTYTDSATL
SVGASNVNLLHFVGHTNDGTGACVGDVCLMGDECEDNVPFIAEPERIQSQIQNLGKTIQTVQNQGVDKVCPAHGN
GNTIAQGCFPLSLCQSNMQYLQIMASDLQAACGQSLQELAPQIGRQPGDITKAYAGVHKENCQALSQVQGGSRRG
RG
Coding >Ophio5|2609
ATGTTCCTGAACAGGGTTCAGAATACGTCGGCGCCGTTGTTCGCTTGCTATATTGGTGGTGAGGCGGGAAGGGAG
CCGCAGAATGCGCTGCAGAAGGCGACGGTGAACTTGGGGAACGAGGAGCCCGATTCGAATAATGACTTGGGCGTC
ACGAGTTATTTCCTCTCGGACGGGCAGCAGGCCATGATGTTTGATACGTTGACGTCGCCGGTGCTTGCTTCTGCC
TGCCTGGAAATGGTGCAGAACAGCAACCAGGGCGGCAATCAACAGAACAACATCGGGCAGGTTCAGCAGGTTGTG
CTCAGCCACAAGCACCAGGATCACATCGCCGGCCTCTCTGCGCCCGAGCTCAAGCAAGCAAAAGTCATCACGCAA
GACAACACCAGGCAAGCTCTGGCACAAGCCAATTCCCGCCCCCCGGATCAGACTTACACGGATTCAGCAACTCTG
TCGGTCGGAGCCAGCAACGTCAACCTGCTTCACTTTGTCGGACACACAAACGACGGCACCGGAGCATGCGTAGGC
GACGTCTGTCTGATGGGAGACGAGTGCGAAGACAACGTTCCCTTCATCGCGGAGCCCGAACGAATCCAGTCGCAG
ATTCAGAACCTGGGCAAGACGATCCAGACGGTGCAGAACCAGGGCGTCGACAAGGTGTGTCCGGCGCACGGCAAT
GGAAACACCATCGCCCAGGGCTGCTTTCCTCTGTCGCTCTGTCAGTCCAACATGCAGTATCTGCAGATCATGGCT
AGCGATCTCCAGGCCGCTTGTGGGCAGTCGCTTCAAGAGCTCGCGCCCCAGATTGGGAGGCAGCCGGGGGATATC
ACGAAGGCTTATGCGGGCGTGCACAAGGAGAATTGCCAGGCGCTGAGCCAGGTCCAGGGCGGTTCCCGGCGAGGT
AGAGGT
Transcript >Ophio5|2609
ATGTTCCTGAACAGGGTTCAGAATACGTCGGCGCCGTTGTTCGCTTGCTATATTGGTGGTGAGGCGGGAAGGGAG
CCGCAGAATGCGCTGCAGAAGGCGACGGTGAACTTGGGGAACGAGGAGCCCGATTCGAATAATGACTTGGGCGTC
ACGAGTTATTTCCTCTCGGACGGGCAGCAGGCCATGATGTTTGATACGTTGACGTCGCCGGTGCTTGCTTCTGCC
TGCCTGGAAATGGTGCAGAACAGCAACCAGGGCGGCAATCAACAGAACAACATCGGGCAGGTTCAGCAGGTTGTG
CTCAGCCACAAGCACCAGGATCACATCGCCGGCCTCTCTGCGCCCGAGCTCAAGCAAGCAAAAGTCATCACGCAA
GACAACACCAGGCAAGCTCTGGCACAAGCCAATTCCCGCCCCCCGGATCAGACTTACACGGATTCAGCAACTCTG
TCGGTCGGAGCCAGCAACGTCAACCTGCTTCACTTTGTCGGACACACAAACGACGGCACCGGAGCATGCGTAGGC
GACGTCTGTCTGATGGGAGACGAGTGCGAAGACAACGTTCCCTTCATCGCGGAGCCCGAACGAATCCAGTCGCAG
ATTCAGAACCTGGGCAAGACGATCCAGACGGTGCAGAACCAGGGCGTCGACAAGGTGTGTCCGGCGCACGGCAAT
GGAAACACCATCGCCCAGGGCTGCTTTCCTCTGTCGCTCTGTCAGTCCAACATGCAGTATCTGCAGATCATGGCT
AGCGATCTCCAGGCCGCTTGTGGGCAGTCGCTTCAAGAGCTCGCGCCCCAGATTGGGAGGCAGCCGGGGGATATC
ACGAAGGCTTATGCGGGCGTGCACAAGGAGAATTGCCAGGCGCTGAGCCAGGTCCAGGGCGGTTCCCGGCGAGGT
AGAGGTTGA
Gene >Ophio5|2609
ATGTTCCTGAACAGGGTTCAGAATACGTCGGCGCCGTTGTTCGCTTGCTATATTGGTGGTGAGGCGGGAAGGGAG
CCGCAGAATGCGCTGCAGAAGGCGACGGTGAACTTGGGGAACGAGGAGCCCGATTCGAATAATGACTTGGGCGTC
ACGAGTTATTTCCTCTCGGACGGGCAGCAGGCCATGATGTTTGATACGTTGACGTCGCCGGTGCTTGCTTCTGCC
TGCCTGGAAATGGTGCAGAACAGCAACCAGGGCGGCAATCAACAGAACAACATCGGGCAGGTTCAGCAGGTTGTG
CTCAGCCACAAGCACCAGGATCACATCGCCGGCCTCTCTGCGCCCGAGCTCAAGCAAGCAAAAGTCATCACGCAA
GACAACACCAGGCAAGCTCTGGCACAAGCCAATTCCCGCCCCCCGGATCAGACTTACACGGATTCAGCAACTCTG
TCGGTCGGAGCCAGCAACGTCAACCTGCTTCACTTTGTCGGACACACAAACGACGGCACCGGAGCATGCGTAGGC
GACGTCTGTCTGATGGGAGACGAGTGCGAAGACAACGTTCCCTTCATCGCGGAGCCCGAACGAATCCAGTCGCAG
ATTCAGAACCTGGGCAAGACGATCCAGACGGTGCAGAACCAGGGCGTCGACAAGGTGTGTCCGGCGCACGGCAAT
GGAAACACCATCGCCCAGGGCTGCTTTCCTCTGTCGCTCTGTCAGTCCAACATGCAGTATCTGCAGATCATGGCT
AGCGATCTCCAGGCCGCTTGTGGGCAGTCGCTTCAAGAGCTCGCGCCCCAGATTGGGAGGCAGCCGGGGGATATC
ACGAAGGCTTATGCGGGCGTGCACAAGGAGAATTGCCAGGCGCTGAGCCAGGTCCAGGGCGGTTCCCGGCGAGGT
AGAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail