Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2605
Gene name
Locationscaffold_212:9178..11016
Strand-
Gene length (bp)1838
Transcript length (bp)1611
Coding sequence length (bp)1608
Protein length (aa) 536

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.2E-21 116 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 29 483 1.0E-60
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 24 505 2.0E-52
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 116 293 7.0E-17
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 119 296 5.0E-08
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 116 295 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 29 483 1.0E-60
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 24 505 2.0E-52
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 116 293 7.0E-17
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 119 296 5.0E-08
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 116 295 5.0E-08
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 119 296 1.0E-07
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 115 306 1.0E-07
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 116 295 3.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 222 333 1.0E-06
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 119 296 1.0E-06
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 116 301 4.0E-06
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 119 285 5.0E-06
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 116 296 7.0E-06
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 107 293 7.0E-06
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 115 303 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1541 0.09 0.8536 0.0863 0.1458 0.0567 0.2144 0.3317 0.1265 0.0519

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99567

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 5.3E-47 114 301

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.0 0.0 0.0
CcL In ants, during behavior modification 0.0 0.0 0.0
CcD In ants, recently dead 0.0 0.0 0.0

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Orthologs

Orthofinder run ID4
Orthogroup133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7793
Ophiocordyceps australis map64 (Brazil) OphauB2|5097
Ophiocordyceps camponoti-floridani Ophcf2|00778
Ophiocordyceps camponoti-floridani Ophcf2|03867
Ophiocordyceps camponoti-rufipedis Ophun1|5948
Ophiocordyceps camponoti-rufipedis Ophun1|6363
Ophiocordyceps kimflemingae Ophio5|1641
Ophiocordyceps kimflemingae Ophio5|2605 (this protein)
Ophiocordyceps kimflemingae Ophio5|3904
Ophiocordyceps subramaniannii Hirsu2|10680
Ophiocordyceps subramaniannii Hirsu2|1755
Ophiocordyceps subramaniannii Hirsu2|6804
Ophiocordyceps subramaniannii Hirsu2|9391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2605
MKPISSFCLLSSLTTAGCSLTANCKTLPGDRDWPSTTIWESLNSTLNGRLLAPPPPAAVCHTEQPLHNASACPSL
REAWTHSAWHSENPVSVMWDQFTNFSCLPEPSTPCSSRGYPAYVIDASTAEHVRVGINFAKEHNIRLIVKSSGHD
FIGRSVGPGALSIWTHHLDSIEFHPDQFELDGSRRLISGNAMTLGGGVEMYNAYKAADKYNQTLVGGGGKTVACG
GFISGGGHSFIAPHYGLAADNVLQMEVVTPSGHVLTVNEDRHPELFWALRGGGGSTFGVITKVTMSTHPSVKVTS
VNWMIVTDPQAPYLIDVISFVVSKIPYLMDEGLYGGNYVDHSLPNPVAAPGVLREVGGIMGKNLMLAVDKPNMVE
KMFEPINNTLNARWSGNVVLHLKVQEHPSFLAWFEINHDSSPVGRSRYLVSRLLDKQTLTGNEPTLRNALKTANE
PNGLLAFFAVAGKGVQNAKPRGGNAVHPAWRLSYVHAVATAEFPPLNKTAEQEAIEILDRSFQPLRDLTPNSGSK
NKRLTVSMSFN
Coding >Ophio5|2605
ATGAAACCCATCTCGTCGTTCTGTCTTCTCTCTAGCCTCACCACCGCCGGCTGTTCACTCACCGCAAACTGTAAA
ACCTTGCCAGGAGACCGTGATTGGCCTTCGACGACCATCTGGGAGAGCCTGAATAGCACTCTCAACGGACGCCTC
CTCGCTCCGCCCCCTCCGGCCGCTGTTTGTCACACCGAGCAGCCCTTACATAACGCGAGTGCATGCCCTAGTCTG
AGGGAAGCATGGACTCACAGCGCATGGCACTCAGAAAACCCAGTGTCTGTCATGTGGGACCAGTTCACCAACTTC
AGCTGTCTGCCTGAACCCAGTACCCCGTGCAGCAGTCGGGGTTACCCTGCCTATGTCATCGACGCATCGACCGCG
GAGCATGTCAGGGTTGGCATCAACTTTGCCAAAGAGCACAACATCAGGCTCATCGTCAAAAGCTCTGGCCACGAC
TTCATCGGCCGCTCCGTTGGCCCTGGGGCATTATCCATCTGGACACACCACCTGGACAGCATCGAGTTCCACCCA
GATCAATTCGAGCTCGACGGCTCACGGAGATTGATAAGTGGTAATGCCATGACGCTGGGCGGCGGAGTCGAAATG
TACAATGCTTATAAGGCTGCCGACAAGTACAACCAAACTCTTGTTGGCGGCGGGGGCAAAACTGTTGCCTGTGGC
GGCTTCATCTCAGGCGGCGGCCATTCCTTCATTGCACCACACTATGGCTTAGCTGCTGACAACGTCCTGCAAATG
GAGGTCGTTACTCCAAGTGGCCATGTTCTTACCGTTAACGAGGATCGTCATCCCGAGCTTTTCTGGGCCTTGAGA
GGAGGCGGTGGCTCAACCTTTGGCGTCATCACCAAAGTTACCATGTCCACCCACCCCAGCGTCAAGGTAACCTCT
GTGAACTGGATGATCGTCACTGATCCTCAGGCGCCTTATCTCATCGATGTCATCTCCTTCGTAGTCTCCAAGATT
CCTTATCTCATGGACGAGGGACTTTACGGGGGAAACTATGTCGACCACAGCCTTCCGAATCCCGTGGCAGCGCCT
GGTGTGCTCCGGGAGGTCGGCGGAATAATGGGCAAGAACTTGATGCTGGCTGTGGACAAGCCAAACATGGTAGAG
AAGATGTTCGAACCGATAAACAATACTCTCAATGCGAGATGGTCCGGAAACGTGGTGCTTCACCTAAAGGTACAG
GAACATCCCTCGTTCTTGGCCTGGTTCGAGATCAATCACGACTCAAGCCCGGTAGGAAGAAGTCGTTATCTTGTA
TCACGACTTCTGGACAAGCAGACACTCACAGGCAATGAACCGACGCTGCGAAATGCCCTGAAAACAGCCAATGAG
CCTAATGGCCTCTTGGCTTTCTTTGCCGTTGCCGGCAAGGGTGTCCAGAATGCAAAGCCGCGGGGAGGAAACGCT
GTTCATCCAGCTTGGCGCCTGTCTTATGTGCATGCTGTCGCCACCGCCGAGTTCCCACCATTGAACAAGACAGCC
GAGCAGGAGGCCATCGAGATCCTTGACAGATCATTCCAGCCACTGCGTGATTTGACGCCCAATTCGGGGTCGAAG
AACAAGCGGCTAACGGTTTCAATGTCTTTCAAC
Transcript >Ophio5|2605
ATGAAACCCATCTCGTCGTTCTGTCTTCTCTCTAGCCTCACCACCGCCGGCTGTTCACTCACCGCAAACTGTAAA
ACCTTGCCAGGAGACCGTGATTGGCCTTCGACGACCATCTGGGAGAGCCTGAATAGCACTCTCAACGGACGCCTC
CTCGCTCCGCCCCCTCCGGCCGCTGTTTGTCACACCGAGCAGCCCTTACATAACGCGAGTGCATGCCCTAGTCTG
AGGGAAGCATGGACTCACAGCGCATGGCACTCAGAAAACCCAGTGTCTGTCATGTGGGACCAGTTCACCAACTTC
AGCTGTCTGCCTGAACCCAGTACCCCGTGCAGCAGTCGGGGTTACCCTGCCTATGTCATCGACGCATCGACCGCG
GAGCATGTCAGGGTTGGCATCAACTTTGCCAAAGAGCACAACATCAGGCTCATCGTCAAAAGCTCTGGCCACGAC
TTCATCGGCCGCTCCGTTGGCCCTGGGGCATTATCCATCTGGACACACCACCTGGACAGCATCGAGTTCCACCCA
GATCAATTCGAGCTCGACGGCTCACGGAGATTGATAAGTGGTAATGCCATGACGCTGGGCGGCGGAGTCGAAATG
TACAATGCTTATAAGGCTGCCGACAAGTACAACCAAACTCTTGTTGGCGGCGGGGGCAAAACTGTTGCCTGTGGC
GGCTTCATCTCAGGCGGCGGCCATTCCTTCATTGCACCACACTATGGCTTAGCTGCTGACAACGTCCTGCAAATG
GAGGTCGTTACTCCAAGTGGCCATGTTCTTACCGTTAACGAGGATCGTCATCCCGAGCTTTTCTGGGCCTTGAGA
GGAGGCGGTGGCTCAACCTTTGGCGTCATCACCAAAGTTACCATGTCCACCCACCCCAGCGTCAAGGTAACCTCT
GTGAACTGGATGATCGTCACTGATCCTCAGGCGCCTTATCTCATCGATGTCATCTCCTTCGTAGTCTCCAAGATT
CCTTATCTCATGGACGAGGGACTTTACGGGGGAAACTATGTCGACCACAGCCTTCCGAATCCCGTGGCAGCGCCT
GGTGTGCTCCGGGAGGTCGGCGGAATAATGGGCAAGAACTTGATGCTGGCTGTGGACAAGCCAAACATGGTAGAG
AAGATGTTCGAACCGATAAACAATACTCTCAATGCGAGATGGTCCGGAAACGTGGTGCTTCACCTAAAGGTACAG
GAACATCCCTCGTTCTTGGCCTGGTTCGAGATCAATCACGACTCAAGCCCGGTAGGAAGAAGTCGTTATCTTGTA
TCACGACTTCTGGACAAGCAGACACTCACAGGCAATGAACCGACGCTGCGAAATGCCCTGAAAACAGCCAATGAG
CCTAATGGCCTCTTGGCTTTCTTTGCCGTTGCCGGCAAGGGTGTCCAGAATGCAAAGCCGCGGGGAGGAAACGCT
GTTCATCCAGCTTGGCGCCTGTCTTATGTGCATGCTGTCGCCACCGCCGAGTTCCCACCATTGAACAAGACAGCC
GAGCAGGAGGCCATCGAGATCCTTGACAGATCATTCCAGCCACTGCGTGATTTGACGCCCAATTCGGGGTCGAAG
AACAAGCGGCTAACGGTTTCAATGTCTTTCAACTAA
Gene >Ophio5|2605
ATGAAACCCATCTCGTCGTTCTGTCTTCTCTCTAGCCTCACCACCGCCGGCTGTTCACTCACCGCAAACTGTAAA
ACCTTGCCAGGAGACCGTGATTGGCCTTCGACGACCATCTGGGAGAGCCTGAATAGCACTCTCAACGGACGCCTC
CTCGCTCCGCCCCCTCCGGCCGCTGTTTGTCACACCGAGCAGCCCTTACATAACGCGAGTGCATGCCCTAGTCTG
AGGGAAGCATGGACTCACAGCGCATGGCACTCAGAAAACCCAGTGTCTGTCATGTGGGACCAGTTCACCAACTTC
AGCTGTCTGCCTGAACCCAGTACCCCGTGCAGCAGTCGGGGTTACCCTGCCTATGTCATCGACGCATCGACCGCG
GAGCATGTCAGGGTTGGCATCAACTTTGGTACGTCTACATATTCCTTCCAAGCATGGTAAAGAGACGATATCTGA
ATAGCGGGTAGCCAAAGAGCACAACATCAGGCTCATCGTCAAAAGCTCTGGCCACGACTTCATCGGCCGCTCCGT
TGGCCCTGGGGCATTATCCATCTGGACACACCACCTGGACAGCATCGAGTTCCACCCAGATCAATTCGAGCTCGA
CGGCTCACGGAGATTGATAAGTGGTAATGCCATGACGCTGGGCGGCGGAGTCGAAATGTACAATGCTTATAAGGC
TGCCGACAAGTACAACCAAACTCTTGTTGGCGGCGGGGGCAAAACTGTTGCCTGTGGCGGCTTCATCTCAGGCGG
CGGCCATTCCTTCATTGCACCACACTATGGCTTAGCTGCTGACAACGTCCTGCAAATGGAGGTCGTTACTCCAAG
TGGCCATGTTCTTACCGTTAACGAGGATCGTCATCCCGAGCTTTTCTGGGCCTTGAGAGGAGTACGTGCCCCATG
TAATTGTTGATCCATCCGTGACTAACGTATTCCATTGCGATTCAGGGCGGTGGCTCAACCTTTGGCGTCATCACC
AAAGTTACCATGTCCACCCACCCCAGCGTCAAGGTAACCTCTGTGAACTGGATGATCGTCACTGATCCTCAGGCG
CCTTATCTCATCGATGTCATCTCCTTCGTAGTCTCCAAGATTCCTTATCTCATGGACGAGGGACTTTACGGGGGA
AACTATGTCGACCACAGCCTTCCGAATCCCGTGGCAGCGCCTGGTGTGCTCCGGGAGGTCGGCGGAATAATGGGC
AAGAACTTGATGCTGGCTGTGGACAAGCCAAACATGGTAGAGAAGATGTTCGAACCGATAAACAATACTCTCAAT
GCGAGATGGTCCGGAAACGTGGTGCTTCACCTAAAGGTACAGGAACATCCCTCGTTCTTGGCCTGGTTCGAGATC
AATCACGACTCAAGCCCGGTAGGAAGAAGTCGTTATCTTGTATCACGACTTCTGGACAAGCAGACACTCACAGGC
AATGAACCGACGCTGCGAAATGCCCTGAAAACAGCCAATGAGCCTAATGGCCTCTTGGCTTTCTTTGCCGTTGCC
GGCAAGGGTGTCCAGAATGCAAAGCCGCGGGGAGGAAACGCTGTTCATCCAGCTTGGCGCCTGTCTTATGTGCAT
GCTGGTATAAATCTGTGTTCACCTAGGGGAGAAGTCGCATTGTCTGCTAACCGTCTTCGATAGTCGCCACCGCCG
AGTTCCCACCATTGAACAAGACAGCCGAGCAGGAGGCCATCGAGATCCTTGACAGATCATTCCAGCCACTGCGTG
ATTTGACGCCCAATTCGGGGTCGTACGTTAACGAGGTTTGGCCATCTCCAGTCTGTCTTAATATTTCCCTTAGGA
AGAACAAGCGGCTAACGGTTTCAATGTCTTTCAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail