Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2587
Gene name
Locationscaffold_210:28986..30475
Strand+
Gene length (bp)1489
Transcript length (bp)1224
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 1.2E-25 51 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 52 338 3.0E-52
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 52 338 5.0E-51
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 52 338 2.0E-50
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 52 338 2.0E-50
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 64 338 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 52 338 3.0E-52
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 52 338 5.0E-51
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 52 338 2.0E-50
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 52 338 2.0E-50
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 64 338 2.0E-41
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 56 338 2.0E-39
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 64 338 3.0E-37
sp|Q94EI9|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana GN=At3g14410 PE=2 SV=1 52 338 7.0E-37
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 26 346 7.0E-25
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 39 338 6.0E-22
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 51 346 2.0E-21
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 51 346 1.0E-20
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 53 338 1.0E-18
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 59 334 1.0E-18
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 59 334 5.0E-17
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 53 338 6.0E-17
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 13 337 2.0E-16
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 40 337 6.0E-16
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 5 338 2.0E-14
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 43 338 4.0E-14
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 109 338 8.0E-12
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 58 339 8.0E-11
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 27 338 3.0E-10
sp|Q9M5A9|GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1 27 338 5.0E-10
sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 43 338 8.0E-10
sp|Q9LF61|XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana GN=XPT PE=1 SV=1 58 346 7.0E-09
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 60 338 9.0E-09
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 128 338 6.0E-08
sp|Q69VR7|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT1 PE=2 SV=1 56 338 1.0E-07
sp|P29463|TPT_SOLTU Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1 56 339 2.0E-07
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 128 338 4.0E-07
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 56 339 4.0E-07
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 56 338 5.0E-07
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 56 338 6.0E-07
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 56 339 8.0E-07
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 56 339 9.0E-07
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 67 338 1.0E-06
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 34 339 1.0E-06
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 128 338 1.0E-06
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 56 346 2.0E-06
sp|P52178|TPT2_BRAOB Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1 9 338 2.0E-06
sp|P52177|TPT1_BRAOB Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1 56 339 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 78 97 19
3 117 139 22
4 141 163 22
5 173 190 17
6 195 217 22
7 232 254 22
8 267 289 22
9 293 315 22
10 322 341 19
11 371 389 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2587
MAPTSPPPLPSAEASPALSQSTTDVFDMAYDEPDGDKGPQSSSSKGLHPALHIANWIFFSNITILFNKWILDSAG
FRYPILLTTWHLVFSVVATQVLARSTSLLDSRHKLPMTPRLYLRTICPIGLFYSGSLVCSNLVYLYLSVAFIQML
KSAAPVAVLFASWAWRVSDPNLAALINVLVIVAGVALASFGEIQFSLIGFLYQIGGIIFEAIRIVMIQVMLSGQG
LNMDPLVGLYYYAPVCAGMNMLVALFTEIPRFKWDDLANVGLFMLLLNALIAFMLNIASVFLIGKTSGLVMTLSG
IFKNILLIVVSVIIWRTEITPLQGVGYTIALAGLLYYSLGYDQLAKCFHGAVAWVAATIAPPPSALQVRRLVLVA
IFTLTGLLVFIVGLRRYDGKATYSPRLAVGTE
Coding >Ophio5|2587
ATGGCTCCGACCTCGCCGCCCCCGTTGCCATCGGCCGAGGCCTCGCCCGCTCTCTCGCAATCGACCACCGACGTC
TTCGATATGGCCTACGACGAGCCCGATGGCGACAAAGGACCTCAATCGTCCTCCTCCAAGGGCCTTCATCCCGCC
CTGCACATCGCTAACTGGATCTTCTTCTCCAACATCACCATATTATTTAACAAATGGATTCTCGACTCCGCTGGT
TTCAGATACCCCATCCTTTTGACCACCTGGCACCTCGTCTTCTCCGTCGTCGCCACACAGGTCCTCGCACGCTCG
ACGTCGCTCCTCGATTCGCGCCATAAGCTGCCCATGACGCCCCGCCTCTACCTTCGCACCATCTGCCCTATCGGT
CTTTTCTACTCGGGCTCCCTCGTCTGCTCGAATCTCGTGTACCTCTACCTCTCCGTCGCCTTTATCCAGATGCTC
AAGTCGGCCGCCCCCGTCGCCGTCCTCTTCGCCTCGTGGGCTTGGCGTGTTTCCGACCCCAACCTCGCCGCCTTG
ATCAACGTTCTTGTCATCGTCGCCGGCGTCGCGCTCGCCTCTTTTGGTGAGATCCAATTCTCACTCATCGGCTTC
CTCTACCAGATCGGTGGCATCATTTTCGAAGCTATTCGCATTGTTATGATCCAGGTCATGCTCAGCGGCCAGGGG
CTTAACATGGATCCCCTTGTCGGACTCTACTACTACGCCCCAGTCTGCGCCGGCATGAATATGCTCGTCGCCCTG
TTCACCGAGATACCGCGCTTCAAGTGGGATGATTTGGCCAACGTCGGTCTCTTTATGCTCCTTCTCAATGCCCTC
ATCGCCTTTATGCTCAACATTGCTAGCGTCTTCTTGATTGGCAAGACGTCTGGCCTCGTCATGACGCTAAGTGGC
ATCTTTAAGAACATCCTGCTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACGCCCCTCCAGGGCGTC
GGCTATACCATTGCCCTCGCAGGCCTCCTCTACTACTCCCTCGGCTACGACCAGCTGGCCAAATGCTTTCACGGC
GCCGTCGCCTGGGTGGCCGCCACCATCGCACCGCCGCCCTCTGCCTTGCAAGTCCGAAGGCTCGTCCTCGTCGCC
ATTTTCACCCTCACCGGTCTGCTCGTCTTCATTGTTGGCCTGCGACGCTACGACGGCAAGGCTACCTATTCGCCT
CGTCTGGCTGTCGGCACAGAG
Transcript >Ophio5|2587
ATGGCTCCGACCTCGCCGCCCCCGTTGCCATCGGCCGAGGCCTCGCCCGCTCTCTCGCAATCGACCACCGACGTC
TTCGATATGGCCTACGACGAGCCCGATGGCGACAAAGGACCTCAATCGTCCTCCTCCAAGGGCCTTCATCCCGCC
CTGCACATCGCTAACTGGATCTTCTTCTCCAACATCACCATATTATTTAACAAATGGATTCTCGACTCCGCTGGT
TTCAGATACCCCATCCTTTTGACCACCTGGCACCTCGTCTTCTCCGTCGTCGCCACACAGGTCCTCGCACGCTCG
ACGTCGCTCCTCGATTCGCGCCATAAGCTGCCCATGACGCCCCGCCTCTACCTTCGCACCATCTGCCCTATCGGT
CTTTTCTACTCGGGCTCCCTCGTCTGCTCGAATCTCGTGTACCTCTACCTCTCCGTCGCCTTTATCCAGATGCTC
AAGTCGGCCGCCCCCGTCGCCGTCCTCTTCGCCTCGTGGGCTTGGCGTGTTTCCGACCCCAACCTCGCCGCCTTG
ATCAACGTTCTTGTCATCGTCGCCGGCGTCGCGCTCGCCTCTTTTGGTGAGATCCAATTCTCACTCATCGGCTTC
CTCTACCAGATCGGTGGCATCATTTTCGAAGCTATTCGCATTGTTATGATCCAGGTCATGCTCAGCGGCCAGGGG
CTTAACATGGATCCCCTTGTCGGACTCTACTACTACGCCCCAGTCTGCGCCGGCATGAATATGCTCGTCGCCCTG
TTCACCGAGATACCGCGCTTCAAGTGGGATGATTTGGCCAACGTCGGTCTCTTTATGCTCCTTCTCAATGCCCTC
ATCGCCTTTATGCTCAACATTGCTAGCGTCTTCTTGATTGGCAAGACGTCTGGCCTCGTCATGACGCTAAGTGGC
ATCTTTAAGAACATCCTGCTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACGCCCCTCCAGGGCGTC
GGCTATACCATTGCCCTCGCAGGCCTCCTCTACTACTCCCTCGGCTACGACCAGCTGGCCAAATGCTTTCACGGC
GCCGTCGCCTGGGTGGCCGCCACCATCGCACCGCCGCCCTCTGCCTTGCAAGTCCGAAGGCTCGTCCTCGTCGCC
ATTTTCACCCTCACCGGTCTGCTCGTCTTCATTGTTGGCCTGCGACGCTACGACGGCAAGGCTACCTATTCGCCT
CGTCTGGCTGTCGGCACAGAGTGA
Gene >Ophio5|2587
ATGGCTCCGACCTCGCCGCCCCCGTTGCCATCGGCCGAGGCCTCGCCCGCTCTCTCGCAATCGACCACCGACGTC
TTCGATATGGCCTACGACGAGCCCGATGGCGACAAAGGACCTCAATCGTCCTCCTCCAAGGGCCTTCATCCCGCC
CTGCACATCGCGTATGACGCCCTGTTCCTCCCCCCTGCTCTCCTCTGTTTTCTTGCGCTGACGAACCGTCCGCGT
TTAGTAACTGGATCTTCTTCTCCAACATCACCATATTATTTAACAAATGGATTCTCGACTCCGCTGGTTTCAGTA
CGCCTTTCCCCCCCCTCAGAAACGTCTCGTTTCCGCAAGCTAACAGCTCTCCATAGGATACCGTGCGTTTCCCCG
AGCTTTGCCTCTCTGCGTTGAGCAGACCCTTCCCATCCCGCCTCGTCGCTCCCACGGCTAACAGCTCTCATAGCC
ATCCTTTTGACCACCTGGCACCTCGTCTTCTCCGTCGTCGCCACACAGGTCCTCGCACGCTCGACGTCGCTCCTC
GATTCGCGCCATAAGCTGCCCATGACGCCCCGCCTCTACCTTCGCACCATCTGCCCTATCGGTCTTTTCTACTCG
GGCTCCCTCGTCTGCTCGAATCTCGTGTACCTCTACCTCTCCGTCGCCTTTATCCAGATGCTCAAGTCGGCCGCC
CCCGTCGCCGTCCTCTTCGCCTCGTGGGCTTGGCGTGTTTCCGACCCCAACCTCGCCGCCTTGATCAACGTTCTT
GTCATCGTCGCCGGCGTCGCGCTCGCCTCTTTTGGTGAGATCCAATTCTCACTCATCGGCTTCCTCTACCAGATC
GGTGGCATCATTTTCGAAGCTATTCGCATTGTTATGATCCAGGTCATGCTCAGCGGCCAGGGGCTTAACATGGAT
CCCCTTGTCGGACTCTACTACTACGCCCCAGTCTGCGCCGGCATGAATATGCTCGTCGCCCTGTTCACCGAGATA
CCGCGCTTCAAGTGGGATGATTTGGCCAACGTCGGTCTCTTTATGCTCCTTCTCAATGCCCTCATCGCCTTTATG
CTCAACATTGCTAGCGTCTTCTTGGTATGGACAATCCGCACCTTTTCTAATGCATCGGCAGCTAACCGCGTCGCA
GATTGGCAAGACGTCTGGCCTCGTCATGACGCTAAGTGGCATCTTTAAGAACATCCTGCTCATCGTTGTCTCAGT
CATCATCTGGCGCACCGAGATCACGCCCCTCCAGGGCGTCGGCTATACCATTGCCCTCGCAGGCCTCCTCTACTA
CTCCCTCGGCTACGACCAGCTGGCCAAATGCTTTCACGGCGCCGTCGCCTGGGTGGCCGCCACCATCGCACCGCC
GCCCTCTGCCTTGCAAGTCCGAAGGCTCGTCCTCGTCGCCATTTTCACCCTCACCGGTCTGCTCGTCTTCATTGT
TGGCCTGCGACGCTACGACGGCAAGGCTACCTATTCGCCTCGTCTGGCTGTCGGCACAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail