Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2584
Gene name
Locationscaffold_210:22602..24515
Strand-
Gene length (bp)1913
Transcript length (bp)1290
Coding sequence length (bp)1287
Protein length (aa) 429

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 8.4E-36 160 406
PF06155 GBBH-like_N Gamma-butyrobetaine hydroxylase-like, N-terminal 1.1E-09 59 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UB1|TMLH_NEUCR Trimethyllysine dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-1 PE=2 SV=2 36 426 2.0E-92
sp|A5DCB6|TMLH_PICGU Trimethyllysine dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00921 PE=3 SV=2 61 426 4.0E-74
sp|Q91ZE0|TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus GN=Tmlhe PE=1 SV=2 39 418 4.0E-60
sp|Q0VC74|TMLH_BOVIN Trimethyllysine dioxygenase, mitochondrial OS=Bos taurus GN=TMLHE PE=2 SV=1 51 418 5.0E-59
sp|Q91ZW6|TMLH_RAT Trimethyllysine dioxygenase, mitochondrial OS=Rattus norvegicus GN=Tmlhe PE=1 SV=2 69 414 7.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UB1|TMLH_NEUCR Trimethyllysine dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-1 PE=2 SV=2 36 426 2.0E-92
sp|A5DCB6|TMLH_PICGU Trimethyllysine dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00921 PE=3 SV=2 61 426 4.0E-74
sp|Q91ZE0|TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus GN=Tmlhe PE=1 SV=2 39 418 4.0E-60
sp|Q0VC74|TMLH_BOVIN Trimethyllysine dioxygenase, mitochondrial OS=Bos taurus GN=TMLHE PE=2 SV=1 51 418 5.0E-59
sp|Q91ZW6|TMLH_RAT Trimethyllysine dioxygenase, mitochondrial OS=Rattus norvegicus GN=Tmlhe PE=1 SV=2 69 414 7.0E-59
sp|Q9NVH6|TMLH_HUMAN Trimethyllysine dioxygenase, mitochondrial OS=Homo sapiens GN=TMLHE PE=1 SV=1 69 418 1.0E-58
sp|Q5F4B3|TMLH_CHICK Trimethyllysine dioxygenase, mitochondrial OS=Gallus gallus GN=TMLHE PE=2 SV=1 69 418 5.0E-58
sp|P80193|BODG_PSESK Gamma-butyrobetaine dioxygenase OS=Pseudomonas sp. (strain AK-1) PE=1 SV=1 36 415 6.0E-29
sp|Q5R5D8|BODG_PONAB Gamma-butyrobetaine dioxygenase OS=Pongo abelii GN=BBOX1 PE=2 SV=1 60 418 4.0E-28
sp|O75936|BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens GN=BBOX1 PE=1 SV=1 60 418 6.0E-28
sp|Q9QZU7|BODG_RAT Gamma-butyrobetaine dioxygenase OS=Rattus norvegicus GN=Bbox1 PE=1 SV=1 60 418 4.0E-27
sp|Q924Y0|BODG_MOUSE Gamma-butyrobetaine dioxygenase OS=Mus musculus GN=Bbox1 PE=1 SV=1 60 418 4.0E-26
sp|Q98KK0|BODG_RHILO Probable gamma-butyrobetaine dioxygenase OS=Rhizobium loti (strain MAFF303099) GN=mll1440 PE=3 SV=1 59 428 5.0E-26
sp|P23180|AIM17_YEAST Probable oxidoreductase AIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM17 PE=1 SV=2 56 418 2.0E-18
sp|Q19000|BODG_CAEEL Probable gamma-butyrobetaine dioxygenase OS=Caenorhabditis elegans GN=gbh-1 PE=3 SV=1 60 410 1.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.112 0.1216 0.0491 0.0473 0.9274 0.083 0.0183 0.0216 0.0516 0.0107

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6283
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2655
Ophiocordyceps australis map64 (Brazil) OphauB2|1620
Ophiocordyceps camponoti-floridani Ophcf2|05862
Ophiocordyceps kimflemingae Ophio5|2584 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8395

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2584
MAQLGFAFRVACRASRFGTRTANLWRHNEIARGTARFFTTKLEIISEAPNHIDVGETAEDGKSVVLSKLWLRDCC
RCEECVDKETMQRKFNILAYRQDGPMSVESKDDDGFVMRFPDHHTSRFTWDWVREQLPGFEILDMNPRKSMKLWN
REILLRELPEVEYSEVMDPSSQEGMAKLCSKIRQSGICFVTGTPVTPEATKELIESIGPIRQTHYGGFYDFQADH
SKADSAYTNAALDLHTDTTYFTEPAGIQALHLLSHTPSSDEPSDEKLGGETILVDGFFVAHRQRMEFRSHFDLLQ
RAPVRWHASGNADVAVIPDKDYPIIGTHLGVLQQIRWNMADRGFLSLDVHAGKMIGAMRSWDSIMRRPENKYQFQ
LAPGRVLLMDNWRILHGRTAFTGDRRICGAYISRDDFVSKWKLTNFDRKEVSEV
Coding >Ophio5|2584
ATGGCACAGCTCGGATTTGCCTTTCGCGTCGCCTGCCGGGCCTCTAGGTTCGGCACCCGAACTGCAAACCTTTGG
CGTCACAACGAAATCGCCCGAGGAACCGCGAGATTTTTCACTACCAAACTGGAAATTATCAGCGAGGCTCCGAAT
CACATCGACGTTGGCGAAACCGCGGAGGATGGTAAATCTGTGGTGCTGTCCAAGCTATGGTTGAGAGATTGCTGT
CGTTGCGAGGAGTGCGTCGACAAGGAAACGATGCAGAGAAAATTCAACATTCTAGCGTATCGGCAAGATGGGCCC
ATGTCAGTCGAGTCAAAAGACGACGACGGTTTTGTGATGCGTTTTCCCGACCACCACACGAGCCGCTTCACTTGG
GATTGGGTCCGAGAACAACTCCCCGGCTTTGAGATCCTGGATATGAACCCCAGAAAGTCAATGAAGCTTTGGAAT
CGCGAAATCTTGTTGAGGGAGCTTCCAGAGGTTGAATACAGTGAAGTCATGGATCCCTCAAGCCAGGAGGGAATG
GCCAAGCTGTGCAGCAAAATCCGCCAATCCGGTATTTGTTTCGTTACCGGCACCCCTGTCACCCCTGAGGCGACC
AAAGAGTTGATCGAAAGCATTGGACCGATCCGACAAACGCACTACGGCGGTTTCTACGACTTTCAAGCGGACCAT
TCCAAGGCCGACTCGGCGTACACGAACGCTGCTCTTGACCTCCACACGGACACGACCTATTTTACTGAACCAGCC
GGCATCCAGGCCCTCCATCTTCTTTCTCACACGCCCTCATCGGATGAGCCCTCCGACGAGAAATTGGGTGGTGAG
ACGATACTTGTTGATGGGTTCTTCGTAGCTCATCGGCAGCGGATGGAGTTCAGATCCCACTTCGACTTACTCCAA
AGGGCTCCGGTTCGTTGGCACGCCAGCGGCAACGCGGATGTTGCCGTAATACCGGACAAGGATTATCCCATCATC
GGTACACACCTCGGCGTACTGCAGCAGATCCGCTGGAACATGGCCGACCGCGGTTTTCTTTCCTTGGATGTCCAT
GCCGGGAAAATGATAGGCGCAATGAGGAGTTGGGACAGCATCATGAGAAGGCCGGAAAATAAGTATCAGTTCCAG
TTGGCGCCGGGCCGTGTGCTCTTGATGGACAACTGGCGAATCCTACATGGCAGAACGGCATTCACAGGAGACAGG
CGCATCTGCGGCGCTTACATCTCCCGAGATGATTTTGTCTCCAAGTGGAAGTTGACCAACTTTGACCGGAAAGAA
GTATCAGAAGTC
Transcript >Ophio5|2584
ATGGCACAGCTCGGATTTGCCTTTCGCGTCGCCTGCCGGGCCTCTAGGTTCGGCACCCGAACTGCAAACCTTTGG
CGTCACAACGAAATCGCCCGAGGAACCGCGAGATTTTTCACTACCAAACTGGAAATTATCAGCGAGGCTCCGAAT
CACATCGACGTTGGCGAAACCGCGGAGGATGGTAAATCTGTGGTGCTGTCCAAGCTATGGTTGAGAGATTGCTGT
CGTTGCGAGGAGTGCGTCGACAAGGAAACGATGCAGAGAAAATTCAACATTCTAGCGTATCGGCAAGATGGGCCC
ATGTCAGTCGAGTCAAAAGACGACGACGGTTTTGTGATGCGTTTTCCCGACCACCACACGAGCCGCTTCACTTGG
GATTGGGTCCGAGAACAACTCCCCGGCTTTGAGATCCTGGATATGAACCCCAGAAAGTCAATGAAGCTTTGGAAT
CGCGAAATCTTGTTGAGGGAGCTTCCAGAGGTTGAATACAGTGAAGTCATGGATCCCTCAAGCCAGGAGGGAATG
GCCAAGCTGTGCAGCAAAATCCGCCAATCCGGTATTTGTTTCGTTACCGGCACCCCTGTCACCCCTGAGGCGACC
AAAGAGTTGATCGAAAGCATTGGACCGATCCGACAAACGCACTACGGCGGTTTCTACGACTTTCAAGCGGACCAT
TCCAAGGCCGACTCGGCGTACACGAACGCTGCTCTTGACCTCCACACGGACACGACCTATTTTACTGAACCAGCC
GGCATCCAGGCCCTCCATCTTCTTTCTCACACGCCCTCATCGGATGAGCCCTCCGACGAGAAATTGGGTGGTGAG
ACGATACTTGTTGATGGGTTCTTCGTAGCTCATCGGCAGCGGATGGAGTTCAGATCCCACTTCGACTTACTCCAA
AGGGCTCCGGTTCGTTGGCACGCCAGCGGCAACGCGGATGTTGCCGTAATACCGGACAAGGATTATCCCATCATC
GGTACACACCTCGGCGTACTGCAGCAGATCCGCTGGAACATGGCCGACCGCGGTTTTCTTTCCTTGGATGTCCAT
GCCGGGAAAATGATAGGCGCAATGAGGAGTTGGGACAGCATCATGAGAAGGCCGGAAAATAAGTATCAGTTCCAG
TTGGCGCCGGGCCGTGTGCTCTTGATGGACAACTGGCGAATCCTACATGGCAGAACGGCATTCACAGGAGACAGG
CGCATCTGCGGCGCTTACATCTCCCGAGATGATTTTGTCTCCAAGTGGAAGTTGACCAACTTTGACCGGAAAGAA
GTATCAGAAGTCTGA
Gene >Ophio5|2584
ATGGCACAGCTCGGATTTGCCTTTCGCGTCGCCTGCCGGGCCTCTAGGTATGTCCCGTTCGTCGTTTTACTTCAC
AGTTAAGCATGGCTAACAGCTGCGTCAGGTTCGGCACCCGAACTGCAAACCTTTGGCGTCACAACGAAATCGCCC
GAGGAACCGCGAGATTTTTCACTACCAAACTGGAAATTATCAGCGAGGCTCCGAATCACATCGACGTTGGCGAAA
CCGCGGAGGATGGTAAATCTGTGGTGCTGTTCGTACATCATTCCCTTGTCTCTCATTCAGCGCTCAACTGAGATT
TCCCACACAGGTCCAAGCTATGGTTGAGGTATGTATGAGCAATCTCATTTGGCCTCTAATCGGAAATTCAAAGTC
TTCGCAGAGATTGCTGTCGTTGCGAGGAGTGCGTCGACAAGGAAACGATGCAGAGAAAATTCAACATTCTAGCGG
TATCATCCCCGCCAAGCAACCCCTGGTCAAGCCCTAACCGATTTACTGACTTTCTCGCTGTCGTCAGTATCGGCA
AGATGGGCCCATGTCAGTCGAGTCAAAAGACGACGACGGTTTTGTGATGCGTTGTAAGCCAAACCCCTTCACTTT
ATGCGTTGGCGGCGGCTTCTGAAGTCCGGCACTCAAGTTCCCGACCACCACACGAGCCGCTTCACTTGGGATTGG
GTCCGAGAACAACTCCCCGGCTTTGAGATCCTGGATATGAACCCCAGAAAGTGCGTCTTCATGTCGTTGGCGACA
ATTACGATCTAGCTTACAGGGGACAGGTCAATGAAGCTTTGGAATCGCGAAATCTTGTTGAGGGAGCTTCCAGAG
GTTGAATACAGTGAAGTCATGGATCCCTCAAGCCAGGAGGGAATGGCCAAGCTGTGCAGCAAAATCGTGAGCACT
CACTTAAGCCGGGACCTCGCGTAAGGCTAACGAGAACAGCGCCAATCCGGTATTTGTTTCGTTACCGGCACCCCT
GTCACCCCTGAGGCGACCAAAGAGTTGATCGAAAGCATTGGACCGATCCGACAAACGCACTACGGCGGTTTCTAC
GACTTTCAAGCGGACCATTCCAAGGCCGACTCGGCGTACACGAACGCTGCTCTTGACCTCCACACGGACACGACC
TATTTTACTGAACCAGCCGGCATCCAGGCCCTCCATCTTCTTTCTCACACGCCCTCATCGGATGAGCCCTCCGAC
GAGAAATTGGGTGGTGAGACGATACTTGTTGATGGGTTCTTCGTAGCTCATCGGCAGCGGATGGAGTTCAGATCC
CACTTCGACTTACTCCAAAGGGCTCCGGTTCGTTGGCACGCCAGCGGCAACGCGGATGTTGCCGTAATACCGGAC
AAGGATTATCCCATCATCGGTACACACCTCGGCGTACTGCAGCAGATCCGCTGGAACATGGCCGACCGCGGTTTT
CTTTCCTTGGATGTCCATGCCGGGAAAATGATAGGCGCAATGAGGAGTTGGGACAGCATCATGAGAAGGCCGGAA
AATAAGTATCAGTTCCAGTTGGCGCCGGGCCGTGTGCTCTGTGCGTTGCCCCATTTCGCAGCTGATAATGATGCG
ACGGCGCGCTGACGTGATGATAGTGATGGACAACTGGCGAATCCTACATGGCAGAACGGCATTCACAGGAGACAG
GCGCATCTGCGGCGCTTACAGTGAGTGCTCCGTCCTCTCCCTCTTGCAACGCCACGCCGCTGACGGGATACGCCG
TGCAGTCTCCCGAGATGATTTTGTCTCCAAGTGGAAGTTGACCAACTTTGACCGGAAAGAAGTCATTGCAGCCAA
TATGTAGTTGTGAGGAGCTATCGCGTGTTTGTTCATCAAGGTATCAGAAGGTCTGTCTATCACATTACAAGCCGG
TCAGGCCCGCGTTTCTAAACGACGGGACTTCAGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail